SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000241767|PACid:22665328 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000241767|PACid:22665328
Domain Number 1 Region: 710-962,1065-1109
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.29e-62
Family FAD-linked reductases, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 944-1055
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.16e-26
Family L-aminoacid/polyamine oxidase 0.00039
Further Details:      
 
Domain Number 3 Region: 452-547
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000017
Family SWIRM domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000241767|PACid:22665328
Sequence length 1246
Sequence
MVDKMDGEEKKSGLQIRSKFVKANMVDSEDDEPIGSLLKLKRQRNLKKVKGGGERGKMVD
DEEENLGGLDDTLASLRKKLKGPKKDYGTGTMRGRSFALDGVQSVDQSSNEHVDDRGLDG
KSASRVLEKDPVMGDDGSDVTINIEVENKLNGKGKRPKISGSLGFGEGSNCLLDHHPEDS
LSAFSRKSQSGLIMNSRASSIPKEKSGSKVLEDGLNTMPLAGSNQLDSASDQCKEDESQS
FDDRASNRHRENQETFNDKKHKRPYKVVSEDRVPLYSHSGFDSKLIKNEAIVDPSGSNFQ
EGPCSSDEVNDGDKKHLTQQMQTFEDGLKNCSMGGNCNGLISYTKNLGLASGPLRDENDV
PNHDHLITSEEADENESFPEDTVSLPDVENKNTKLSAVQRVGRIVRKRRHGDMAYEGDAD
WEVLINDQSLNSDNLRVKFDSSSSIGTESESGEAAAVSAGLKAHAVGPVEKIKFKEILKR
RGGVQDYLECRNQILALWNKDVSRILPLADCGVTYTACADEPPRASLIRDIYTFLDLSGY
INIGIAREKDKAESGPKHDYKILREKNFEEIFGVSVADSEDGVSFITGQVKSSRTKTDAK
SGVIIKSDNSTHEVTKDNGLVTTAALELSNTKNHAECEADHPENTSVDARLQSKLDNMDV
SSSDPISETLGDGGIPLETPELKNVSHSTQCASQDHAVRNNNPQCGLEVKKKIIVIGAGP
AGLTAARHLQRQGFSVTILEARSRIGGRVYTDRSSLSVPVDLGASIITGVEADWATERRP
DPSSLVCAQLGLELTVLNSDCPLYDIATGXKVPADLDEALEAEFNSLLDDMEVSLPNWNQ
DDVYGGFGGAHCXIKGGYSTVVESLGEGLXIHLNHVVTDISYXTKDAGLNTNRXNKVKVS
TSNGSDFSGDAILITVPLGCLKAETIKFSPPLPHWKHSSILRLGFGVLNKVVLEFPXVFW
DDSVDYFGATAEETELRGQXFMFWNVKKTVGAPVXIALVVGKAAIDGQNMSSSEHVXHXI
VVLRKLFGEASVPDPVAXVVTDWGKDPFSYGAYSYVAVGAXGEDYDILGRPVENCLFFAG
EATCKEHPDTVGGAMMSGLREAVRIIDILTTGNDYTAEADAIAGIQRQSDSERAEVRDIT
RRLDAVELSDVLYMNKEALLQDMFFNAKTTKGRLHLAKELLSLPVETLKSFAGTKEGLTT
LNSWILDSMGKAGTQLLRHCVRLLVLVSTDLLAVRLSGIGKTVREK
Download sequence
Identical sequences MDP0000241767 MDP0000241767|PACid:22665328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]