SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000243606|PACid:22673449 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000243606|PACid:22673449
Domain Number 1 Region: 212-280
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.0000000000000654
Family F1F0 ATP synthase subunit C 0.011
Further Details:      
 
Domain Number 2 Region: 152-198
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000000000562
Family F1F0 ATP synthase subunit C 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000243606|PACid:22673449
Sequence length 288
Sequence
MVSKSHSASRPDTQKYSPKISGWXKTRTHRARVKQQSPSSTSHHITRIRSDTLPTLSSPP
QIFPHNFTSTIRVSXNVRCSSSXGLLELLGTRPRPDLSLHFLRYRHRRRHRRFCPRRXLV
FPFSLFPLHFLIKVLIFGLITDDEYXWMEIRGIYITGSSLIGAAIKAPRITSKNLISVIF
CEAVAIYGVIVAIILQTKLESVPTSKIYAPESLRAGYAIFASGIIVGFANLVCGLCVGII
GSSCALSDAQNSSLFVKILVIEIFGSALGLFGVIVGIIMSAQATWPSK
Download sequence
Identical sequences MDP0000243606 MDP0000243606|PACid:22673449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]