SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000244560|PACid:22658795 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000244560|PACid:22658795
Domain Number 1 Region: 479-792
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-83
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 73-190
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-22
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  MDP0000244560|PACid:22658795
Domain Number - Region: 366-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000647
Family Hairpin loop containing domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000244560|PACid:22658795
Sequence length 811
Sequence
MVLDAQSFCVFFTLLLLSLISCAEEIYDITPSRPLAQGQTLISAGNVFELGFFNNSANKY
VGIWHKDILPRKVVWVANXEKPIAATDTSAGLTISSNGSLEIVDGKQNSVWSTNFSGTAS
SLNNGSAAVAVLLDDGNFVVKFNVGVAADQYLWESFDYPSDTLQPQMLMGFDSVSGTRNS
LTSWKSENDPSTGMFLAGLSHEEPSQLVVWINGSTPYWRSGPWDKSKFIGVPEMDDQYRS
GFNLEDNKQQGTKYFSFDLFAKTIAAFMDISSEGVLRLIYSKHGENWNTFWEAPAAKNPC
DNYGACGPFGVCKASGSPICKCLKGFVPKSREEWSRGNRAGGCVRQTKLFCESNTSQSVA
SRGNGDGFTKMSSVKLPDFHEFISSLDAEKCKIQCLNNCSCLAYAYVNNIGCLVWPKDLI
DIQEFSSGGEDLFIRLRHTKSVTKSGNIKVTKKFVELTDPNENSSDSTLQEYIREHEQSD
LFIYRFDSVSIATNNFSITNKLGEGGFGPVYKGKLKEGKEIAVKRLSSNSGQGVEEFKNE
VLLISKLQHKNLVRIMGCCVKDDEKLLVYEFMPNGSLDTILFNPXRRAELDWARRFNVIQ
GVARGLLYLHHDSRLKVIHRDLKVSNILLDENMNPKISDFGLARIVQGTQKLENTQKVVG
TLGYMAPEYAMGGILSEKSDVYSFGVLLLEIVSGTKNTSFYYHEKQLGFLAYSWHLWNEG
RGLDLVDEVLGDSYPSSQAMRCVHIGLLCIQDNATDRPTMPDVVLMLSSETDRPQPQRPI
FTFQKSVSNPQSQKDSIYSANVDTITTIEGR
Download sequence
Identical sequences MDP0000244560 MDP0000244560|PACid:22658795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]