SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000246280|PACid:22622500 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000246280|PACid:22622500
Domain Number 1 Region: 312-351
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000667
Family F1F0 ATP synthase subunit C 0.0089
Further Details:      
 
Domain Number 2 Region: 239-302
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.0000131
Family F1F0 ATP synthase subunit C 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000246280|PACid:22622500
Sequence length 417
Sequence
MPRNEFWGFNKLRSILELLRRNRSLTGNASPGPFPATAVSKVDQGYSIQQGLRYLSVNSK
PWTKLDTKMVNSGKEKAQQLQPAATPTRLGIGQRVKWILGSILALILPLWTQNWGKLKRI
EREAEMVVEEVEKVAEVVERVATVAEKVSEDVADELPDNTKLKEKVLLAEHVFEVAAKDA
KQAEDFIHKHETHQPPLKKNAERKIGDSKLLLRYRDDVVPDPRSIMSSTFSGDETAPFFG
FLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVI
ISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRLVVRCCSLVSEDY
VRASNGPCLVVVRLRFSFNRIKAFEAVKVFSSFGVFFREKYMTWYRSIILKLLHVHG
Download sequence
Identical sequences MDP0000246280|PACid:22622500 MDP0000246280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]