SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000247472|PACid:22642530 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000247472|PACid:22642530
Domain Number - Region: 120-153
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000301
Family F1F0 ATP synthase subunit C 0.0095
Further Details:      
 
Domain Number - Region: 48-110
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00127
Family F1F0 ATP synthase subunit C 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000247472|PACid:22642530
Sequence length 154
Sequence
MFELLRLHPNPQIRSHHPIPATIHTHSHTQRYMASSTFSGDETATFFGFLNAATTLVFFC
MGTAYGTANSGMGMVSMGVIRSELVMKSIVPVVMARVLGIYGLIIAVIISTGINPKAKSY
YLFDGYTHLSSGLACGLAGLFAGMATGIVGGAGV
Download sequence
Identical sequences MDP0000247472 MDP0000247472|PACid:22642530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]