SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000250536|PACid:22643447 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000250536|PACid:22643447
Domain Number 1 Region: 401-688
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-76
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Weak hits

Sequence:  MDP0000250536|PACid:22643447
Domain Number - Region: 301-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000250536|PACid:22643447
Sequence length 743
Sequence
MVVKLLSHVILFTLLLRLLAVASSQKPPIAKPNCQSHCGDIEIPYPFGIGAGCYIDDDWF
QIICDNSTGNPTPFLNRTNLEVLEISAEGGTLKVTNPITFSNCSNKPINRQTANLEGSPF
AYSTKNVFTAVGCGFMATITSNSNGYSISSGCKSECDISINKSNGTRHNVCNGVDCCQTA
IPSFLSAFNTSFQRDDDKTRSSCNYAFLVDRKWFQGYANNLTNISAISDRDNIPVVLEWN
MFHSTTEVFGTFLEVNATVWRDDPIRPSCDSYNDNSSVYGSSRLECTCGGGSEGNPYLLD
GCQDINECEVGKHSCSEPLVCVNHRSGYGCYYPPKSKSPVKAIIIGIGSGLGFLLLLLGA
WWLHKLIKKTKAIKRKKKFFKQNGGILLEQQLAAGEVNVEKIKLFNSQELEMATDHFNID
RILGQGGQGTVYKGMLTDGRIVAVKKSKLVDGGEIAQFINEIVILSQINHRNVVKLLGCC
LETEVPLLVYEFIPKGTIYQYLHKENEEFLXTWEMRLRIAAEVAGALSYLHSAAGFPIYH
RDIKSTNILLDDKYRAKVADFGTSRSVSIDQTHLTTIVHGTFGYLDPEYFQSSQFTDKSD
VYSFGVVLLELLTGEKSVSLTRSPEIRGLVTYFNFSMEENRLFDIIDARVKEEGVKEDIL
SVANXANRCLDMSGKRRPTMKEVAMELERIQKSVNASNNLQQNSDEVEYVRNEVTGPWDV
TSTGSCLAGGTTPSKDSLPLLSY
Download sequence
Identical sequences MDP0000250536 MDP0000250536|PACid:22643447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]