SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000251205|PACid:22649529 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000251205|PACid:22649529
Domain Number 1 Region: 116-218
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.55e-25
Family N-acetyl transferase, NAT 0.0086
Further Details:      
 
Domain Number 2 Region: 221-306
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.26e-18
Family PHBH-like 0.014
Further Details:      
 
Domain Number 3 Region: 302-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.07e-16
Family FAD-linked reductases, N-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000251205|PACid:22649529
Sequence length 427
Sequence
MGAGREVQSSLDGLRDKNVMQLKKLNTALFPVRYNDKYYADALASGDFTKLGFCSFCVFH
SLSCCLFASGHPKWNLFMGRAGKYWALAHCIWKCWVWSLGFGYTFEECRQHKCTTYFSDI
CVGAIACRLEKKENGAVRVYIMTLGVLAPYRGLGIGKKLLNHSLDLCAKQNISEIYLHVQ
TNNEDAINFYKKFGFEITETIQNYYTNITPPDCYVLTKNTPELGKCLYFGLGSGTHTVLY
ELPNRRLNWIWYVHQPEPDLKPNSMTMKASSDMIQSMHKEAEKMWLPEFVRVIRETKEPF
INXIYDSDPLEKIYWDXVVLVGDAAHPTTPHALRSTNMSVLDAAVLGQCLKKWGAEDLQF
ALEXYQSIRLPVVRKQVLHARRMGRIKQGLVLPDRQLXNPETANPEECHELQQKLMPFFT
DVPSILL
Download sequence
Identical sequences MDP0000251205 MDP0000251205|PACid:22649529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]