SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000251865|PACid:22623956 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000251865|PACid:22623956
Domain Number 1 Region: 504-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-77
Family Protein kinases, catalytic subunit 0.0000869
Further Details:      
 
Domain Number 2 Region: 390-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000543
Family EGF-type module 0.0082
Further Details:      
 
Weak hits

Sequence:  MDP0000251865|PACid:22623956
Domain Number - Region: 355-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00142
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000251865|PACid:22623956
Sequence length 851
Sequence
MMDILRQFADRCLRFKGEERPTMKGVAKELEGMKVAAKHPWGKADFCSEETGSLRGSPNS
DTYFVDVIADSVLHAAMSACKSSILPKQLAYLPALNSMAINGRTLLIQLSLAVISAATIT
KLAAADGPLTQALPGCKDKCGDLTIPYPFGIGDGCYLRPEFNITCDHSATPPAANLTGQT
FRITKFSLGEGELQVMMFISRDCYAMVDSHARRTYRNNPALWLPPPYTISDTKNRFIAVG
CDTYALFQGYRGEERFITGCMSLCNSLGSVSDSNCAGVGCCQTSIPSGLKNCTVQLSSYY
NHSFIMDFNPCSYAFTVEQGQFEFSSTSFDQLTNTSLLPMVINWEIEDKTCYSACKANNS
VCVNRAVNISGSGYICQCLGGYQGNPYLPHSCQDIDECKSSNPCSIGTCVNVPGNFSCKC
PEGYKNDGTDRQSCIKDNPNNLLLMISLGVTGGFLILLAGISWTYWAMQRRKIIKLQEKY
FKENGGLLLQQQLASQEGSVEAIKIFTGEELKRATNNYHDSRIVGEGGYGIVYKGVLPDS
NKVVAIKKSKIGVPTQKEQFVNELIVLSQINHRNVVRLLGCCLETSVPLLVYEFITNGTL
FEHIHHKNGRGSSFSWELRLKIAAETAGALAYLHSSALMQIIHRDVKATNILLDDNYTAK
VSDFGASRLIPLDQNQLTTLVQGTYGYLDPEYFLTNQLTEKSDVYSFGVVLMELLTSKVA
LSFARPEEERNLASLFVCAMEEDRLNQILDQDIVNDGNIQTVKHVANLAKGCVRLKXGDR
PTMKEVAMELEGMRTTSNHSWGKADFTPEETQYYLGSPSSDTYSTVAVRGDFSGTKGSME
IQMLMPYDDGR
Download sequence
Identical sequences MDP0000251865|PACid:22623956 MDP0000251865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]