SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000258644|PACid:22675686 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000258644|PACid:22675686
Domain Number 1 Region: 475-767
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-76
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 78-194
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-22
Family alpha-D-mannose-specific plant lectins 0.005
Further Details:      
 
Weak hits

Sequence:  MDP0000258644|PACid:22675686
Domain Number - Region: 156-258
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000185
Family alpha-D-mannose-specific plant lectins 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000258644|PACid:22675686
Sequence length 977
Sequence
MALQTHIRFSLLLLIASLLSAAVSAATTISPGSSLSAANLNTTWSXPSDTFSLGFIPSDP
PTSPPSYIAAISYSGGVPVWSAGAGKAVDSGGTLQFLQSGTLRLVNGSGATLWDSNTASL
GVSSAEITDSGNLVLRNGTVTVWSSFDNPTDSIVPGQNLTVGKVLRSGLYSFKLVKNGNL
TLLWNDSIVYWNQGLNSSVNTNXSSPTLGLQSIGILSITDPKLSTAAIVAYSNDYAEAGD
ILRFLKLGSDGNLRIYSSTRGSGAITERWAAVTNQCEVFGYCGDMGVCSYNDSNPVCGCM
SLNFELVDPKDSRKGCKRKIKTEDCPQNLTMLDLVHTRFLTYPPETETQIFFVGISACRS
NCLVNSVCDASTSLSDGTGLCYYKTPGFLSGYHSPAMSSSSYIKVCGPVIPNPSSSMGTG
DKKKDWKLRAWIVVVVVIATLFALMALEGGLWWWFCRNSPAFGGLSAQYALLEYASGAPV
QFSYKELQRSTKGFKEKLGAGGFGAVYKGILANRTVVAVKQLEGIEQGEKQFRMEVATIS
STHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDSFLFATQEQSGKLLNWESRFNVALGTA
RGITYLHEECRDCIVHCDIKPENILLDENYNAKVSDFGLAKLVSAKDHRYRTLTSVRGTR
GYLAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSEETNRKKFSLWAFEEFEKGNI
KGIVDKRLVDQDVDMDQVKRAIQVTFWCIQEQPSHRPMMGKVLQMLEGITDIETPPGPRA
AIEGSAGGTSMNVSTDITTLSATAASAPAPSSFSSVHVSGVSPLTSGRNTEKATASLIQS
SSLKKQVVPNQAWYLVVMHSHVVHEGALHSEATTEFSAFAASADATFSMPVDLREILPST
LKQAAXSRAGEHKKTFERVCGTEGKFVDLSPTTVILAHVCTSFCWLSLVLIAPPGPPQLS
NNFLSKGDRTRCTVDPX
Download sequence
Identical sequences MDP0000258644 MDP0000258644|PACid:22675686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]