SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000260233|PACid:22661701 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000260233|PACid:22661701
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.05e-19
Family Protein kinases, catalytic subunit 0.0059
Further Details:      
 
Domain Number 2 Region: 209-255
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000114
Family alpha-D-mannose-specific plant lectins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000260233|PACid:22661701
Sequence length 281
Sequence
MRGTVGYLAPEWFSGEAITPKADVFSYGMLLIEVISGRRNREGLADGVENFHPIRLANAV
NRGEDLFTLLDCRLEGKADRDDLSRACKVACWCIQEDEKDRPTMRQVVQILEGVLDIGVP
PVPQFLQRLIRSPAEGINYQETTSDSGSWFSLLGNPVDMLVRYRGKSSCLCNLNADLSCH
RFKSIYACYMLLILMCSCMNVICSRVYREAKLLDNGNFVITDASDSSVVIGQSFDHLTDT
WLPGAELGYNLRTKGKRVLTSRRNLQYPAPRLMVSKFSDFL
Download sequence
Identical sequences MDP0000260233|PACid:22661701 MDP0000260233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]