SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000262759|PACid:22629067 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000262759|PACid:22629067
Domain Number 1 Region: 88-157
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 6.93e-20
Family F1F0 ATP synthase subunit C 0.0048
Further Details:      
 
Domain Number 2 Region: 15-78
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000235
Family F1F0 ATP synthase subunit C 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000262759|PACid:22629067
Sequence length 166
Sequence
MASSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV
VMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDA
GVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRSGQSRAD
Download sequence
Identical sequences M5WAQ2
ppa012508m|PACid:17664570 ppa012515m|PACid:17641010 MDP0000262759|PACid:22629067 MDP0000262759 XP_007202676.1.23749 XP_007227535.1.23749 XP_008219630.1.13088 XP_008241801.1.13088 XP_008338772.1.92800 XP_008372768.1.92800 XP_008378478.1.92800 XP_009338639.1.93535 XP_009378196.1.93535 XP_021815335.1.100051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]