SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000264225|PACid:22669344 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000264225|PACid:22669344
Domain Number 1 Region: 1142-1449
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-76
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 591-695
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-19
Family alpha-D-mannose-specific plant lectins 0.0078
Further Details:      
 
Weak hits

Sequence:  MDP0000264225|PACid:22669344
Domain Number - Region: 842-882
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.011
Family Hairpin loop containing domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000264225|PACid:22669344
Sequence length 1496
Sequence
MSSTVXPLTGVNYKKWKQDLEIVLGVMDWDLALRTEEPPTRTDGSTSSQKSKYEKSLHRC
YQCKGFLKSIXQKYQESPKTETDATNANNFXKSIEEKYQESPKIETGNLMNSLTTMRHDG
IESVCEYILKMVDIAGKLKXLEVLIPETFLVHVILSSLPDSYTHLKLSYNALREKWDVNE
LISVCVSEEERMKKFENEKIKSLNYVRSTTEAHTPLTTDTRKNSTKRVPSPKRNTKPNKP
SILKHYFCIRLGLPYEESNCEWQLRSPTTSKQTWPAAVSTDYTDCNNMQTLXRGINTEPT
PTVAIVVELPSXVEEDEGYDDCYFQHGKNDVLLHGEQQIRHHTRHVEERVSSGNELKHDT
EIEVLLDGEPHAGNQQGHVDEDEAAVNGSNHRLESTVLAVETDFNLSEFCDPGIFKQVIS
SPKIDNWITADIKTMCPKTDLERKMMEDKQYASWVGSLMYAQVCTRPDLAFTISVLGKNN
LRASFRSXGIAFNPEGDQMFDILQIHIQSCLTLFLYLVGVSCVVAVLLCSSHPFCCARDT
VTYDTPITDGVESETLVSSGGRFELGFFSPSPEGTQRYVGIWYHQLSPRTVVWVANREKA
VDNSTSNGSLALQDGNLHVLDAAGKRYWSTEVETSESLTQTVTLMDSGNLVLSSGHDKLA
VNILWQSFQSPTDTFIPGMVMDKSLVLTSWRGEDDPESGRFIFKKDPVREDHKKYVVGNS
SKVFSSPSQNSSYKNPGIPPRSEYNYTRLVINITGEIQFWTWINSTKRWNLNWSAPRDEC
SVFNACGYFGSCNSNNRPLLCKCLPGFKPQYLQQWNSGDFSGGCKRDSALCGNNKIDTFL
SLKKMKVGNPDSKINVEKEEECRNGCLNSCQCKAYSYAISGEYSNRRDASLCKIWNEGDL
NNLEEEYTDGGQDLSVRVALSDLESTVRDCKPCGTTIIPYPLSTSPDCGDPMYFHFKCDN
FTDQVNFDGLILGLNETLFRVISINSSSQRFFIQGFQTENADKCDRMNSGVNSQISTAPP
FKVISLCNADLGNFSSEALSSRSPIVVEMGWEPPVEPPCIKSSDCRDWPHSMCNPASDGK
KRCLCEINFRWNGLKLRCTQELSIVDENKSVRFPVLVQIRRGQFDSERRVKELIDTSEFK
EEEGIDVPFFDMQTILDATDNFSNANKLGQGGYGPVYKGMFIGGQEIAVKRLSRVSGQGL
QEFRNEVVLIAKLQHRNLVRLKGCCMKGEEKILLYEYMPNKSLDFFIFASKFFSIWKMEI
PQDHTKSMFLNWEMRFSIILGIARGLLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDF
GLARIVGGKETQANTNTVVGTYGYMAPEYALDGTFSVKSDVFSFDVVRLEIISGKKNTGF
YQSEQTFSLINYVRQQAWRLWTENKVLDLMDKILDESCNKTQFIQCVNVGLLCVQEDPND
RPAMSNVITLLDNETATSPSPKQPGFLTRGGKYSTASSSSKPEAISEITTSIVEGR
Download sequence
Identical sequences MDP0000264225|PACid:22669344 MDP0000264225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]