SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000264429|PACid:22669771 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000264429|PACid:22669771
Domain Number 1 Region: 151-255
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.11e-21
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 
Weak hits

Sequence:  MDP0000264429|PACid:22669771
Domain Number - Region: 323-398
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000902
Family Hairpin loop containing domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000264429|PACid:22669771
Sequence length 620
Sequence
MGLRPIGSSSSCSRLASKQRRRSEVVQMAERRRYFLINADGKDHDILVAVASLMMFLRGR
LTRSNYVVASLANRMLFSIFVSYAAVLLCSSQPFCCARDTITHDTPITDGVESETLVSSG
GRFELGFFSPSPEGTQRYVGIWYHQLSPRTVVWVANREKPVDNSTSNGSLALQDGNLHVL
DAAGNRYWSTEVKTSESLTQTVTLMDSGNFVLSSGHDKLAVNILWQSFQSPTDTFIPGMV
MDKRLVLTSWRGEDDPKSGQFIFKKDLVREDHCNDNNMPFLCKCLPGFKPQYLPLWNSGD
VSGGCTRKSALCDDNKNYTFLSLKKMKVGNPDSESNIDNETECRNGCLNNCLCKAYSYAK
SESNSHQREAPTSLCRIWNVGDLNNLEEEYTNTGQDLYVRVALSDLESTLRDCKPCGTTI
IPYPLSTRLGCGDPLYFRFKCNYFTGQVSFVGLNDALFRVISINSSTQRFFIQGFHTENV
DNSDPRNRAAKQINPSFPFKVISPGNADLANFSSEVLLSSGPNVVEMGWKLPMEPNCTTS
ADCRDWAHSICKRARGGKKRCLCETNFRWNGLILRCTQGENIMLGIKFRSCMCPLANQIF
MLIPVLQIHFSLYNTVEMII
Download sequence
Identical sequences MDP0000264429|PACid:22669771 MDP0000264429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]