SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000265817|PACid:22656913 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000265817|PACid:22656913
Domain Number 1 Region: 301-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000207
Family EGF-type module 0.0032
Further Details:      
 
Weak hits

Sequence:  MDP0000265817|PACid:22656913
Domain Number - Region: 268-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000265817|PACid:22656913
Sequence length 395
Sequence
MALHRRMHILHLSLVMVVVVTILLATPTPTTAQSLLPPQARPDCPDRCGNLTVPYPFGIG
DGCYLDDRFNITCNISTQPPTAFMMTGNLEITNISLYDGELQILQYVASDCYDAQGNTIE
WYSPWFTVPPPYTISHTKNTFVALGCDTYSFFIGYRGEEKYTTXCTSICNNLGNAIDQRD
TCSGVGCCQTKIPSGLQNXTVELYSYYNHSDVWEFNPCSYAFLVQEGEFNFNSTSFRELN
YTTQVPAIIDWEIGNESCDIAAKNEGTFGCKANSSCHNRSSGYICRCLPGYEGNPYLPDG
CQDIDECXAPNXCSMGTCINTPGNYTCKCPXGYKNDDPDKIRCIKXXGRAKLXLLLIISL
GMHMCQWRPLAFTKWILDILGNAEKKVPQTQRKIL
Download sequence
Identical sequences MDP0000265817 MDP0000265817|PACid:22656913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]