SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000267916|PACid:22629807 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000267916|PACid:22629807
Domain Number 1 Region: 455-740
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.72e-50
Family Carbon-carbon bond hydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 163-231
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 1.57e-17
Family F1F0 ATP synthase subunit C 0.0054
Further Details:      
 
Domain Number 3 Region: 90-153
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.0000379
Family F1F0 ATP synthase subunit C 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000267916|PACid:22629807
Sequence length 844
Sequence
MVERARLLPVEPGIVKCNYVWPGKISLAAQKKREGIFSLQRRSLTDRLHASFLVSYAGST
LVKGQMIYAPFFFLTMSSTTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASM
GVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGL
AGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLICGFLYGVIDVFYQV
DLFKIYIACIIVFSTFVLILVVDVLAGSYVLQYRVTGTSLWGNSTLNLSTVGQIXEDIKA
LLHSITEATVTHTRRNANSIAYCLALARIGMSLSQGCEWNGSPPSVIIDFACRRXISSRM
ADEISRSGDLGTSPATVAAAYESVAVAAAANPKSRSLWPSVLRWIPTSTDKIIAAEKRLL
SLVKTPYVQERVNIGTGPPGSKVRWFRSESNEERQINTVTFDSKENSPTIVMIHGYGASQ
GFFFRNFDALASRFRVIAIDQIGWGGSSRPDFTCKSTEETEAWFIDSFEEWRKAKNLSNF
ILLGHSFGGYVASKYALKHPEHVKHLILVGSAGFSSETDTSYERLNQFKATWKGAIFNHL
WESNFTPQKXVRGLGPLGPNLVRSYTTARFGSYSTGTTLTGEESXLLTDYVYHTLAAKAS
GELCLKYIFSFGAFARSPLIHSASEWKVPTTFIYGYQDWMNYQGAQEAGKKMKVPCEIIR
IPDAGHFVFIDQPDRFHSAVFYACRRFLSPDPAVESFPEVLLVITFTDESSNSCKCIIDT
LCMHKIPTSSVRSRNKRWSGSRESRAYRPIIVVSLFIVAIVVIVNKVETSRKKLRIGKAI
LPVN
Download sequence
Identical sequences MDP0000267916 MDP0000267916|PACid:22629807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]