SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000269570|PACid:22633749 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000269570|PACid:22633749
Domain Number 1 Region: 505-729
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.41e-34
Family Protein kinases, catalytic subunit 0.0015
Further Details:      
 
Domain Number 2 Region: 83-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.49e-21
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Domain Number 3 Region: 174-274
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000388
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Domain Number 4 Region: 778-883
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000166
Family Protein kinases, catalytic subunit 0.018
Further Details:      
 
Weak hits

Sequence:  MDP0000269570|PACid:22633749
Domain Number - Region: 338-385
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00196
Family Anti-platelet protein 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000269570|PACid:22633749
Sequence length 930
Sequence
MPELVEHLRKSRLLLCIFVAFLLNTLATSDIPLGSKISVADKTIWISPNGDFAFGFFNRS
DQPNYSFGIRLISKSFPLDQQLLVWSAAADLIIGNNSYAQLTQDGELVLFDSLKXVTAWT
SKTRQLSVVSAALNDNGNLVLLNQEKHIVWQSFDTPSDILLPGQSFSTLQTLRAASKNCV
SSYYTLFMSASSQLQLQWESHVTYWRSGSLSSSNLSAFITSDGALQLRDQSLKPVWSLYS
QDHNDSISYRFLRLDVDGNLRLYSWVEDSKSWRSVWQAVENQCDVFATCGQRGICVFNES
GSPDCECPFKQQTNESTSRCFIPNNRCSFGSNMLHYKHTFLHGMYPPTDDVVAKVSLEEC
KSLCQNDLACTAATFSNDGTARCLIKRTPYVTGYSDPSLSSVSYAKMCADPLAVNPNLSL
SSPPPLNRSHKFCFPCLIGAAAGMFIVFILVQLALGFWFYRRRISVRKKAAFAHTSPNSN
GLIVLSFSEIEDLTENFKYQIGPKMFKGVLPNRKPVAIKDVDASVEDRKYRGVVTKIGNI
HHKSLVKLQGYCCEVDHKFLVYEYVKNGSLEKYIEDLKLCKKLTWGKRFDICLSVGRAVC
YLHTSCREFMSHGNLKCENVVLDXNLEAKVTEFGLXNIVSKVSCSSCSSAEXDVEDFGKM
VLVLVSXCRVGDLCXWAYKEWLQGHXENVIDRKIIGGFIPQELERALRIAFWCVQIDERR
RPPMREVVKKNNYDTNEVPALFQVAKSSFLRSGHFMILSFVKAVRRFISSGKDNSLGHDL
RPSILSDVKLVNHPGKPLCEWAYKEWLQGHPENVVDRKIIGGFIPQELERALRIAFWCVQ
IDERRRPPMREVVKICFHLSLMIESFRDYIAQFIGRLRQHGTVHNLDGYFQIRAKDAVTG
TGVDLTNAVFTQKLGVVFRSSARAVWLARI
Download sequence
Identical sequences MDP0000269570|PACid:22633749 MDP0000269570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]