SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000271847|PACid:22638495 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000271847|PACid:22638495
Domain Number 1 Region: 64-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.22e-22
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Domain Number 2 Region: 178-272
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000192
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000271847|PACid:22638495
Sequence length 480
Sequence
MTFPVRMLLFTSLFLLPISVFSQNNGRVAVGDSLTATTGDSSSWLYPSGDFAFGFKPLGN
NDRFLLSIWYAKIPETVVWYAIKDNSPVVTPWGSILNLTADSGLVLNNPQGGEIWKSPIT
SGVVANVVMNDTGNFVLQDENSGSLWETFNNPTDTVLPGQTIERKGKLSCKQSEANYEKG
RFQLRLQDDGNLVLNTVNLPTDYANKPYYATGTFSGAEDGSKGKQLVFNSSGDMFVLTEN
GGIHTLTGTQGVSVRDNYIRATLDFDGIFALYSHPKNFTGXASWRSPLWYKPDDICQALL
EDEGVGVCGYNSVCKINPDKRPTCDCPKGFSFLDPKDKYXGCKPDFIQGCEEDKLQSPRK
DLYDVEVLTDTDWPTSDYVQLKPFTAXKCNESCFQDCLCAVAVFRLDTCWKKKLPLSNGR
VDENLNSQTFIKVRKDNVNLQFPPMPIPDDKEKSKTKLIHVVSALLGMTRPDPDISPNIR
Download sequence
Identical sequences MDP0000271847|PACid:22638495 MDP0000271847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]