SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000272319|PACid:22655533 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000272319|PACid:22655533
Domain Number 1 Region: 48-131
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000878
Family Protein kinases, catalytic subunit 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000272319|PACid:22655533
Sequence length 145
Sequence
MPTLAWVSGRATVTERESDRIHGQRRERERELIEGVGEYGLAQREERRVVVPKTYQKYTS
RKVFTTGWIDGEKLSQSTESDVGELVNVGVICYLKQLLDTGMFHADPHPGNMIRTPDGKP
AILDFGNILLIAVLLFSQRPCFHLV
Download sequence
Identical sequences MDP0000272319 MDP0000272319|PACid:22655533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]