SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000272655|PACid:22672104 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000272655|PACid:22672104
Domain Number 1 Region: 43-332,410-473
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.59e-39
Family FAD-linked reductases, N-terminal domain 0.00000043
Further Details:      
 
Domain Number 2 Region: 335-437
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000471
Family GMC oxidoreductases 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000272655|PACid:22672104
Sequence length 476
Sequence
MEKSTTAAILLLLYFFEFCPQPGVSSFANPSDDLGKYSLKVPLVFQNFSYLKFVCNATDL
PLQEEYDYIVVGVGTAGCPLVTTLSANYSVLLLERGNIPSAYPNVLCQNETLANFMQEDD
GKTPVQRFTSEDGVANVRGRILGWSSMINIGIYSRADSEFYEKSGIKLDMNLVNNSYEWV
ENTVIFRPNVTRWQSVVKDAMLEAGVRPDNGLTLDHILGSKVTGTLLDNRGKRHGAVEHL
NKGHPKNLRVAIHATVERIIFSSKASGLSAKGIIYSDSNGRSHRALIRGKGEVILSAGEI
GSPQLLLLSGVGPKSYLSSRKIPVVHPQPYVGQFMRDNPRNYITTLAPFQVEPSTAQFVG
ITSDYYIETFSGLPFSTQAFSLFPSPTIPMTINSSFGHIIFKFPGPLSYGSLKLQSSYDV
KVAPNVVDEDLRVMGIKALRVVDGSVFNLSPGTNPQATLMMLGRYVGVQMLEERSE
Download sequence
Identical sequences MDP0000272655|PACid:22672104 MDP0000272655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]