SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000275770|PACid:22678960 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000275770|PACid:22678960
Domain Number 1 Region: 510-800
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-74
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 80-154,189-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.23e-25
Family alpha-D-mannose-specific plant lectins 0.0017
Further Details:      
 
Weak hits

Sequence:  MDP0000275770|PACid:22678960
Domain Number - Region: 215-304
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.0196
Family Fucose-specific lectin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000275770|PACid:22678960
Sequence length 860
Sequence
MAMSSTYFSTYLVALFFLVVAGFDACSASRIGLGSRLLARENQTLVSDNGTFALGFTPTS
DEDDRLQLAIWFAELPGDRTIVWSANRNSAVSNNAILELDTTGNLVLMDGDATTWTSNTS
GAGVEGATLQESGNFIIYDDVNRPVWQSFSHPSDTLLPNQPLSVSLELTTSKSSPRGGYY
ALKMLQQRTSLSLALTYNMPETLYNSSPESYYNYSYWNGPDISNVTGDVVAVLDEAGSFG
IVYGESSDGAVYVYKNDGDDGGLSAASTRSLVLRRLIIESNGNLRLYRWDNDINGSRQWV
PEWAAVSTPCDIAGICGKGICNLDRSKTNASCTCLPGTYKENGGSLCSENSSLTGKCDSR
SNYQPSQFRISTVQQTNYYFPEFSVIANYSDVENVTKCGEICLADCECVASVYGLDDENP
YCWVLRSMDFGGYEDPASTLFVKVRSNGLEGNAKGSGESSKGSGNQQTKVLVIPIVLSMT
FLVALLCLLLYYNVHRRRSLKRTLESSVILSGAPLNLSYRELQIRTWNFSQLLGTGGFGS
VYKGSLADGTLVAVKKLERVLPHGEKEFITEVNTIGSMHHMNLVRLCGYCSESSQRLLVY
EFMKNGSLDKWIFRSNHSRDKLLDWQSRFDIAVGTAQGIAYFHEQCRDRIIHCDIKPENI
LLDENFCPKVSDFGLAKLMGREHSQVVTMVRGTRGYLAPEWVSNRPITVKADVYSYGMLL
LEIVGGRRNLDMSFDADDFFYPGWAFKEMTSGNPMKVADRRLEGAVEEEELIRALKVAFW
CIQDEIFMRPTMGEVVRMLEGSVGINMPPMPQTVLELIEEGLDHVYKAMKREFNHFSSFT
INTHPSSSQATCSYSTMSPR
Download sequence
Identical sequences MDP0000275770 MDP0000275770|PACid:22678960 XP_008376667.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]