SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000275997|PACid:22679493 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000275997|PACid:22679493
Domain Number 1 Region: 5-31,75-184
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 0.0000000000824
Family Chlorophyll a-b binding protein 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000275997|PACid:22679493
Sequence length 187
Sequence
MVSVAELPKWLDESLPGDRGFDPFGLGNPAEYLQFDYDRLDQNLAKNVAGDIIGTRIETA
EVNPKPLQPYTEVFGLQRFRECELIHGSADRVVVVLMEPPITMLFEEANLQMSRMKRMTK
TRLEVELIEGSSYLDLPLPFSIITLIWIEVLVIDYIEFQRNAELDPEKRLYPGGGKFFDP
LGLAAAG
Download sequence
Identical sequences MDP0000275997|PACid:22679493 MDP0000275997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]