SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000276809|PACid:22649546 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000276809|PACid:22649546
Domain Number 1 Region: 450-578
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-20
Family Protein kinases, catalytic subunit 0.0057
Further Details:      
 
Domain Number 2 Region: 84-173
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000288
Family alpha-D-mannose-specific plant lectins 0.0098
Further Details:      
 
Domain Number 3 Region: 413-453
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000979
Family Protein kinases, catalytic subunit 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000276809|PACid:22649546
Sequence length 581
Sequence
MAATGLTINSIFLIIFACSCSCHDARDTLKPGDTLNSSSLLVSASGKFSLGFYVYNNGST
NTSYLAVQXAAIKASSPVXTVDTNNTLKITYQGGDPIVLYSXTSSTSSVEATILDSGNFV
LQEVSSVNGSTNGVLWQSFDHPTDTFIPGMKLGVDLTNGKNWSLLSWATSYNPAPGLFSL
DWDPKEHELRIKQGGVVYWTSGVFEDGKFKFILPDVSKQKYNFXIVSNANEDYLTYTAAG
DPSDLAPEWVLYGRGTLXEYGAKVDIAEAQNCDGYNMVGGCVRRPRNCTAKLGDGFVDRS
GHFNISHSSNTSEPPNWFGTGTEDCKATCWQNFDLPYGNQTTGAGCRFWRVGTQFIDDPI
GFTPARSGFVLSGSXPXKTQKNGKSRRKWLWISIAIAAALLNQSFSXIGKHDLSVFTYXT
VLAATSNFSEENKLGQGGFGPVYKELEANTSKIVGTFGYMPPEYVMAGXFSVKSDXYGYG
VLMLEIISGRKNNSLHNEDRVLNLVGHAWELWKEGRGIELMDPTLAETCISDQLLRCVQI
GLLCVEENAAHRPTMSEVISMLTNESXKLPVPTKPAFYYTE
Download sequence
Identical sequences MDP0000276809|PACid:22649546 MDP0000276809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]