SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000278523|PACid:22621644 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000278523|PACid:22621644
Domain Number 1 Region: 514-805
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-82
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 72-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.49e-22
Family alpha-D-mannose-specific plant lectins 0.0057
Further Details:      
 
Weak hits

Sequence:  MDP0000278523|PACid:22621644
Domain Number - Region: 351-421
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Pan module (APPLE domain) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000278523|PACid:22621644
Sequence length 842
Sequence
MNFLKGLLNVLVLQHLLLQLCSSLDTIKFDQPVGDGDFLVSKNETFVLGFFSPGXSTNRY
VGIWYKFSEDLVVWVANRDNPINGSSGVLSIGSDGNLVLQANTSQGLVPLWSTNVSISSA
SNGNISAQILDSGSLVLAQQGSQDVFWQSTDHPTNILLSNMKIGLDRRSGINRFLTCWNS
DNDPGTGNVSLRMEPNGSPQLILYKDDAKXWRSGXWNGIQWGGIPAVQRNVVFKINFVNN
QDEIAVQWTVLDPSIYSVITIDXSGTLNQLSWQDQQHQWVSLWSAPLDACDSYGKCGQFG
NCNPYTNSGFNCTCYPGYEPTSPQDWDLRDGTDGCKRPQDSXSMCRNGEGFVKMXNVKVP
DTSSIKLENNLSIVACEEECLKNCSCLAYASADVRNGGTGCMTWYRDLMDTKQFTEGGQD
LYIRVDAVVLAQYKNKSGGGYFSGRRRLAIILVVSISVXSLLILAVLCWFXKRSRKGRGG
EPRFLNDPAASGVRSYEDLPIKNEVDEHRGDTDLPFFDLTTVVAATENFSSANKLGHGGF
GTVYKGCLADGQDIAVKRLSRNSGQGVDEFKNEVMLIAKLQHRNLVRLLGWCIHKEERML
IYEYMPNRSLDLCIFDKNRKSLLDWRKRFQIIIGIARGVLYLHQDSRLKIIHRDLKASNV
LLDGSMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGLYSTKSDVFSFGVL
ALEIISGRKNSFQFENTSLNLVGLIWDLWTEGKVLDIIDSSLNQSYSTHEVMRCIQIGLL
CVQENATDRPTMLDVVFMLGNETNLPRPKKAAFSFKIGGPDSSMSRGASSVNDITVTVIE
AR
Download sequence
Identical sequences MDP0000278523 MDP0000278523|PACid:22621644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]