SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000278929|PACid:22654178 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000278929|PACid:22654178
Domain Number 1 Region: 534-822
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-76
Family Protein kinases, catalytic subunit 0.0000971
Further Details:      
 
Domain Number 2 Region: 414-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000221
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  MDP0000278929|PACid:22654178
Domain Number - Region: 380-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000315
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000278929|PACid:22654178
Sequence length 864
Sequence
MVNERNIETLKTVANLARRCVRLKGEDRPKMKEVAMELEGMRITEMHAWGKAEFIPKETE
YLLGAANSDVYHVDVRADCGPSTGTATEEDMEAVGVDSASKNDDGENDVRKRDDGERRCR
GNEATLEGARRPRRPLGGFDGKSIITSFFRCGNEVGRLGDHPNGFRSVIAEKERRGTGRV
SIYNCRERKKRDKTGFYRDSLAGEGGREGYAIAEKWGGCLVCSKXLLRRGGLSDTKKSNT
PRLKLFPPYTISGTKNKFIAVGCDTYAIFEGVRGSEKYVTGCMTFCESLGSIXESCSGIG
CCQTSIPSGLQVRTVMMSSYSNHTLIWDFNPCSYSFIVEEGQFTFSNRSFQELENTSRLP
MVLNWAIGDEECDAAQKREDYACKGNSTCVSPVNLSGYFCQCLPGYEGNPYPPEGCHDID
ECEISNRCSAGACINLPGNYSCVCPKGFKGDGMKTGTGTGCSKDNGSNLSKSIRLLIISL
AVTVASLIFLVGGSWTYWGMKKNNYIKLREKYFKENGGMLLQQRPASRQGGLVETTKIFT
AEELDKATGYYDDSRVLGEGGYGTVYKGILPDNEVVAIKKSKIGASIQSEQFINEVIVLS
QVNHRNVVKLLGCCLETQVPLLVYEFITRGTLFYHLHNVKSKESSLSWELRLKIAAETAG
ALAYLHSSTSMPIIHRDVKTTNILLXENYTAKVSDFGASRLIPLDQAQITTLVQGTLGYL
DPEYFHSNQLTEKSDVYSFGVVLVELLTRKVALSFTRPEEERNPANFFVCSVEQGRLTQI
LDDDIVTDRNLETLKRVANLASRCLRVKREERPSMKKVAMELEGYRLWRSIHGELLISVQ
RTLXTCSGRLQWLMLEVIVVPVLA
Download sequence
Identical sequences MDP0000278929 MDP0000278929|PACid:22654178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]