SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000279279|PACid:22655053 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000279279|PACid:22655053
Domain Number 1 Region: 495-722
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.7e-50
Family Protein kinases, catalytic subunit 0.00067
Further Details:      
 
Domain Number 2 Region: 761-979
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.67e-32
Family Tyrosine-dependent oxidoreductases 0.0022
Further Details:      
 
Domain Number 3 Region: 79-190
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-22
Family alpha-D-mannose-specific plant lectins 0.0044
Further Details:      
 
Weak hits

Sequence:  MDP0000279279|PACid:22655053
Domain Number - Region: 367-407
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00942
Family Anti-platelet protein 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000279279|PACid:22655053
Sequence length 1460
Sequence
MNTKPNSKFLFSVTLLCAFLESHVSLAADTISENQSLSGDQTIVSAGGMFELGFFKPGQL
SNYYIGMWYSKQVASEMTVVWVANREIPVSDRFSSVLSIFXGNLVLVNESKTPVWSTNLN
STTNSGXVQAVLLDSGNLVLKAGSSNNTSEPLWQSFDHPTHTLLQGGKLGFNKITNHTQI
LTSWKNLEDPAPGFYSLELALDESNSSILLWNRSKQYWTSGSWDETSHXFNAIPEMRLNY
IFNYSYVTNENESYFTYSPKNPKIVSRYLLSASGQIQLLRMENSKQWKLVWSQPRQCDVY
ASCGAFSSCKPTSLNYCKCLKGFEPNQQSDWDLQFYSGGCSRRTGVKCGNAAGDGFLEVN
SGSFPDNRQYEGFLSIESCRSACLNECQCTAYGYDNGCSIWHGDVLNLHEVEANXGDGRT
LYIRAAASDIKEKRVIKPSXLIAIVSTITGLIVVIFGYFLWKKTXGKKREHKKNHNESKS
KFDVGGGKDDAELPIFGLXAXVAATNNFAEANKLGEGGFGPVYKGILAENQEVAIKRLSK
RSGQGHEEFMNELKLIAKLQHTSLVRLLGCCLEDEEMILIYEYMPNRSLDKLLFDASEKI
ELNWGRRFRIIEGIAQGVLYIHNGYMSPEYARYGHFSEKLDVFSFGVLLLEIVSGKKNAA
FYRFEHSPTLAGWAWELWKEGRGMEVIDESVRETCQLDEALRCIHVGFLCVQEAPDDRPT
MSLTATTHHHLDLVTTKLRLMTLKLDSGGATVHCLPDLLRCRQLAESXAHVVMAVRNTKA
ANEXIQKWQNEWSXMGLPLNIXVMELDLLSLDSVVRFAEAWNARLGPLHVLINNAGIFSI
GEPQKFSKDGYEEHLQVNHLAPALLSVLLLPSLIRGSXSRIVNLNSVFVKAGHLLPKAGH
LHIIKCQLTAVIMFSSVLHKRLPAESGISVVCVSPGIVQTNVARDLPRIVQAAYHLVPYF
MFSAQEGSRSALFAATDPQVPEYCELLKTDDFPVCAFISQDCRPTNPSEESHNVDTCHEV
WEKTFEMIGLPSDAVERLIEGEEVACRYGAHGDYTPGTSASYFICSSVVLSLLGIQYSPL
SGPASASASASASASASASASACRKEIGLCGAAASAIICALMSCTPRYMEERMKMVASNT
AQQDTGDTFAERAEAYYKRRPQLLSLLQDLYNAYLTLSDRYIQTIAKTNHRRRHSSQTSI
TDNGYYDDYHDQQDADGDTLSQMDSDVDSSLSYQQLPLAAAAQDDGMVLDLDAIVTEIVM
KNVECDILLDEADTTERRYNESSRKIELQKSLLEVLESERLILLHENAKLGYKMGALMEE
NKALASESMFIKRKAGELARCLLKVREDQRVCMLSRKIEDLQGQIYGLERRNKEYYEQLM
KRDQWSSQLEQEESRSINNKSKFNGNEVNMDICFQIGKINRRLKRGNSTVKDFGAVNGKK
GLSWWGKVKNMDLFLCGGST
Download sequence
Identical sequences MDP0000279279|PACid:22655053 MDP0000279279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]