SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000282332|PACid:22646053 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000282332|PACid:22646053
Domain Number 1 Region: 466-754
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-81
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 72-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.11e-21
Family alpha-D-mannose-specific plant lectins 0.0063
Further Details:      
 
Domain Number 3 Region: 853-975
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.19e-21
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Weak hits

Sequence:  MDP0000282332|PACid:22646053
Domain Number - Region: 349-415
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00785
Family Pan module (APPLE domain) 0.059
Further Details:      
 
Domain Number - Region: 287-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.019
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000282332|PACid:22646053
Sequence length 1019
Sequence
MHFVKGLLNVLILQLLLLQLCSSXDTIKFDQPXGDGDFLVSKNXTFVLGFFSPKISTNRY
VGIWYKFSEDMVVWVANRDNPINGSSGVLSIGFDGNLVLQANTSQGLVPLWSTNVSISLA
SNDNIFAQILDSGSLVLAKQGSQDVFWQSTDHPTNILLSKMKIGLDRRSGINRFLTCWNS
DNDPGMGNVSLRMDLNGSPQLILYKNEAKWWRSGQWDGIQWGGIPAVQRSDVFKINFVNN
TDEVAVQWTVLDPSIYSLNKIDGSGTLNHLVWQEQQNQWVLLWSAPLDACDSYGKCGKFG
NCNPTNIGFNCTCYPGYEPISPKDWDLKDGRGGCKRQQGLRSMCRNGEGFVKMENVKVPD
TSSIKLENNLSLEACKEECLKNCSCLAYASADVRNGGTGCMTWYRDLMDTKQFTEGGQNL
YIRADAVVLGRGGQPKFRNDPTASGSRSYEDLPIKNEVDEHKGETDLPFFDLTTVVAATE
NFSFANMLGHGGFGTVYKGCLADGQDIAVKRLSRNSGQGVDEFKNEVMLIAKLQHRNLVR
LLGWCIHKEERMLIYEYMPNRSLDLCIFDKNRKSSLDWRKRFQIIIGIARGVLYLHQDSR
LKIIHRDLKASNVLLDGSMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGL
YSTKSDVFSFGVLALEIISGRKNSFQFENSSLNLVGIIWDLWTEGKVLDIVDSSLNQSYS
THEVMRCIQIGLLCVQEYATDRPTMLDVVFMLGNETNLPHPKKAAFSFKNRGPDSSKSRG
ASSVNDITALVEILHYFLKYLYSNRDFFVREAIRDGEVLVSSGEVFELGFFSPGKSTKRY
VGIWYMKDVEKRVVWVANRDNPVNDTSGVLSIGANGNLFLYAENQSDIPLWSAISNVSIA
SLSSSSAHEPNYKAQLLDTGNLVVKFQQQDGGEKLTVWQSFYYPKHTMLPSMKLGLDRLT
RLNRFLTSWKSEDDPGTGSCSFRVDPNGAPQMVVYKDDVRWLRFGNLNGNRGWQNSATT
Download sequence
Identical sequences MDP0000282332|PACid:22646053 MDP0000282332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]