SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000282810|PACid:22678879 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000282810|PACid:22678879
Domain Number 1 Region: 429-658
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-58
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 
Domain Number 2 Region: 71-182
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.75e-26
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000282810|PACid:22678879
Sequence length 675
Sequence
MLLKALLVXSLLXPFCTSIDTIEMDQXVKDGDLLVSKENXFALGFFSPRNSSSRYVGIWY
AXKXEKDQKAVVWVANRNDPINDTSGVLTIDRYGRLLLYSNNMQNXPVXSTNVTVQTAST
SCRAQLLDSGNLVLFRDNKSKNFMWQSFDYPTDTLLPGMKLGVNWKLGIEWVLTSWKSQD
DPGTGEYTYRLYSNQTATPEVLTFYKGLTPHWRADLVDVGRSDPLDVGRSDPLDVVTFVS
NQDEMYYFLKNDSTSTRVVLKDSGLLQHLRWNNADREWKELWSTPKYRCDQYGECGANSK
CSPDNINXFXCECLPGYEPKSVNDWKMRDGSDGCVSKRXAVSKCRNGEGFMKXARVKDPD
TTKAARLKKGISIKECEQXCLSNCSCTAYTVIESEGRSDCLTWYGELLDILXKIXEIRKV
FLEXGGVLRNNQNIAVKRLSRATGQGVEEFKNEVALIARLQHRNLVKLLGCCIKGEERML
VLEYLPNKSLDYFLFDHTKKSLLDWQKRFEIINGVARGVLYLHQDSRLRIIHRDLKTSNV
LLDAEMNPKISDFGMARIFHGDQLQDTTNRVVGTYGYMSPEYAVFGRFSTKSDVWQLWSE
DRALEIVDSSLESYAPDEAMRCIQVGLLCVEEESKNRPSMSAVVFMLSGEASTPSPHQPA
FALRRNSFLLWIQMK
Download sequence
Identical sequences MDP0000282810 MDP0000282810|PACid:22678879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]