SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000283260|PACid:22632455 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000283260|PACid:22632455
Domain Number 1 Region: 409-637
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.73e-50
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 
Domain Number 2 Region: 75-185
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-26
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  MDP0000283260|PACid:22632455
Domain Number - Region: 255-319
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00667
Family Pan module (APPLE domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000283260|PACid:22632455
Sequence length 680
Sequence
MQALRSFXMCLFFLFSLLRISAATALGTTITPSGYIRDGETLVSVGGSYELGFFSPGKSK
SRYVGIWYTDSTDAVVWVANRETPLGDSSGLLMLTEQGVLVLLVNSSNKIVWSSNSSRIA
GNPVSQLLDSGNLVVQDGNETNPDNFLWQSFDYPCDTYLPEMKLGWDLVTGLERYLSSWK
STEDPAPGEFSARIDYRGLPQLFVMKRAKKVGRGGSWNGLHLTGFSSGQPNPISRIEFVW
NKDEVYCQFRLLNSHGDGFLTYSGVKLPDTSSSWYDKSMSLEQCKGLCLGNCSCTAYTNL
DVREGGTGCLLWXDNXIDIREFTLGQDLYIRMAASELGIPQTCYVFLSIANNIMTLERQL
LAILLSSAVFLMGMLIVGIILYIRKXKLXNEGLRTKDCXEEYPGEDGEDMELPLFDLTTI
AKATXGFSNCNKLGEGGFGPVYKEGQKLLNWPKCFHIIVGVARGLLYLHQDSRLRIXHRD
LKPSNILLDNNMNPKISDFGLAKTFGGDQSQANTNRVVGTYGYMSSEYAADGIFSMKSDV
FSFGVILLEMLSRKKNRGFRHPDHDHNLLGHAWIRWIQDKPLELIDKTFCDSCNISEVVR
CLHVGLLCVQRVPEXRPSMSSVVLMLSSDVALPPPKQPGFYTERSNLGRSSLRXLLVLQS
TITKRVRKVDVKLIALAGKQ
Download sequence
Identical sequences MDP0000283260|PACid:22632455 MDP0000283260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]