SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000284325|PACid:22650687 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000284325|PACid:22650687
Domain Number 1 Region: 2-85,117-148
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.06e-23
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  MDP0000284325|PACid:22650687
Domain Number - Region: 379-418
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000358
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 
Domain Number - Region: 293-336
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000628
Family Pan module (APPLE domain) 0.072
Further Details:      
 
Domain Number - Region: 597-631
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00628
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000284325|PACid:22650687
Sequence length 800
Sequence
MTVVWVANRETPVSDIFSSALSILDGNLVLFDESKTPVWSTNLNSTTNSGSVQAVLLDSG
NLVLIAGSSNNTSEPLWQSFDHPTHALLPGGKLGFNKITNHTQFLTSWKNLEDPAPGLYS
LELAPDESNSYILLWNRSRQYWTSGPWNESLRNFNMVPELRLFNDFNYSFVTNENESYLT
YSINNPKIVTRGLMSASGQVQQLTWLEASKQWNVFWSQPRQCDVYAFCGAFSSCKPTSSN
YCKCLKGFEPNRQSDWDLQIYSGGCSRRTSVKCGNATGDGFLEKNSKSFLENSQYEPAPS
FESCRSACLNECQCTAYVYDSSNGCSIWHGDVLNLQEFEANDGDGRILYIKAAASDIEKK
RVIKLSPLIAIVSTITELPIFGLKAIIAATNNFAEANKLGEGGFGPVYKLPLKLTPTNFP
SWXAQFNALLLGYXLMGYIDGSKPRPAASSXVCYTFWIRQDQLLLHAILAXVSEQIISLI
SSSKTSKEAWDKLTKLYANKTRSRVLNLKXRLTXMRRDTQPVXVFLQAIKAIIDXLAIID
SPLSDDDVVLHVLNAAXTPMXXLVAQAXRSFQRDFRATXASQQXPTNTTYNSNXXNHHNS
NHXXSTXGYRXFCQWCGTQGHSAXXCPQLSXAPPTVNHTXIRPSTSSPWLLXSGASHHVT
XDSRNIPDSTTYDGPDQIVIGNGTGLSITHVGSTSLSSSSTTPFHLNDVLCVPSISRNII
SIAKFNRQNATSIEFFPDSFLVKDLNTGAALLXGPNKNDTYEWPCLMPQKQVMSSVMDSS
NVWHXRLGHPNHXTYLQIQX
Download sequence
Identical sequences MDP0000284325|PACid:22650687 MDP0000284325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]