SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000285108|PACid:22652374 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000285108|PACid:22652374
Domain Number 1 Region: 463-755
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-74
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 79-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000134
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 
Weak hits

Sequence:  MDP0000285108|PACid:22652374
Domain Number - Region: 176-268
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00802
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Domain Number - Region: 281-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0897
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000285108|PACid:22652374
Sequence length 950
Sequence
MDFELPYSVFFLLLLLVILPISTPAQTYNNISLGSSLTALDDNSSSWRSPSGEFAFGFRQ
LGVDGFLLAIWFNKIPERTIVWSANGGSLVPQGSQVELTNDGQFMLKDKTGKQISFAGSL
GITGVAYAAMLDTGNFCVWPTKVQNICGRVFEEPTNTLLPTQTLNRNSKLYASYTASNYT
PGRFQFALKSDGELLLYTTNYPLDSRNHDYWSTHTEGSGFQVIFSQSGSIYLTGTNGSIL
NMLSDNTSSTQDFYHRAMLEYNGVFRHYVYPKKTGSESTGGGACGFNSLCRDDTEGPVCE
CPDGYSFIDKNDVLKGCKQNFVSQSCDQAFPETHLFDFQEHENRDWPLSDYQHFQPVSED
WCKQSCLSDCFCAVVIFKNDDCWKKGSPLMNGRIDPTVGKKALIKIRIDSNNSRKHSNSI
PNLARLGLLGSSAFLNLLLLIITCLLFFHIIHHRKAKLSMLYPGVQGNNLKSFTYMELKG
ATNGFKQELGRGAFATVFKGVLASEDGKHVAVKRLDTMVRENDLEFKAEVSAIGRTNHKN
LVQLLGFCNEGQRRILVYEFMSNGSLASFLFGESRPSWYQRREIALGTARGILYLHEECS
IQILHCDIKPQNILLDDSFNARIADFGVAKLLKIEQTRTTTRFRGTRGYVAPEWFKSLPV
TVKADVYSFGILLLEIVCCRKNYEAKMEDEDQMILADWAYHCYEQNKLHQLFRNDDDKAK
DDIEEMKTYLMIAFWCIQEDASRRPTMRNVTQMLEGTVELSNPPNPSSLYVQFVYGCPMF
IILQKLKALKTCLRQWNFSVFGDVHNRVANARHNLSMIQQRISTEGINNDLFEEEIVAKT
TVMESLQMQETFWKDRARVKWLTKGDRNSSFFHAYARIKSSSSHISCILDGNNLLTDPLA
IANHIVNFYQTLFGSSFTPSGIDEVCEVIQPMVTDSENDLLSALPTDEEI
Download sequence
Identical sequences MDP0000285108 MDP0000285108|PACid:22652374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]