SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000288794|PACid:22660086 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000288794|PACid:22660086
Domain Number 1 Region: 311-434
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.98e-19
Family alpha-D-mannose-specific plant lectins 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000288794|PACid:22660086
Sequence length 488
Sequence
MPWAGPVPSSSSSQSMQPDTISPNPGPALKKLLRPTQNPLVINEELTAPFDFHRFLNQRP
SPRSMGVLDNNVGKLLQFPADSGVESPALYLTRLDLWSWLTHKKPANSPKPNTVFSSSSS
SSSCSQSAASTFTVNQTKVKQISWKPRAFVYEGLLTDAECDHLISIVKSELKRSAVVGNL
FDSYADSGGESCSEVLXPAQPXLSTVVSVSLPEETERMQRPTTLLHSASVVISPSKIXVP
TSPKSSNFVQASEGELRKNHTAEFMDSNIFQQQRLQQQQPXGLPXFCCXSVEXHRFKQSC
SFQESANPLATKLVWTANRGKLISKSAKFVFDKNGSAYLRGSDSVAWSTNTTGXVASAME
LQDXGNLVLLGDKXXILXQSFSHPTDTXLPGQEFLQGMQLKSFRNSDNVFHYLEIQSGDL
VLYTGYEPPXIYWSLAVGSRRSEREGRSSGSPRINPRCLCDIQPNPSSPLELHIRDAGKW
CQLCRRVV
Download sequence
Identical sequences MDP0000288794 MDP0000288794|PACid:22660086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]