SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000288873|PACid:22644599 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000288873|PACid:22644599
Domain Number 1 Region: 598-880
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-77
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 197-319
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.19e-16
Family alpha-D-mannose-specific plant lectins 0.0068
Further Details:      
 
Domain Number 3 Region: 291-384
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000157
Family alpha-D-mannose-specific plant lectins 0.0073
Further Details:      
 
Weak hits

Sequence:  MDP0000288873|PACid:22644599
Domain Number - Region: 402-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000288873|PACid:22644599
Sequence length 898
Sequence
MDSLGAELIVWLGAGLSVPRWTCSKEITSFARSHDTKGLEGHGGVSGLAGEVSVSLKDGV
VSSKIPIRQTIFGLNRYAGKPSKCEFIQCKLLSSIKGPSWRSLQRREPGKVWEYFERNNL
TCELIPCNLLSSIRGPSWTSLQRREPGKVWEYSKRNDLTWQSNISHGSSLTPTTNSSWLS
RSGVYAFGFYKQGNGYAVGIFLAGIPQTTIVWTAXRDDPPLSSNVTLXFTSQSFVIEYTS
XSSASMLDSGNFVIYNARXDIVWQSFXHPTDTLLPXQSLXXGDELFSAKSESDHSTGIFR
LKMQADGNLVQYPVNTPDTAPYAYYSSXTYGRKNVTLNFGADGHLYLLNDTGSNIRNITD
GGLPADQATIYLMRIDADGIFRLYSHDLNHNGSKSIVWESSKDKCDPKGVCGLNSYCVSM
DLDAKCKCLPGFVFANLGNKTSSCRRIVADVCEYKNETFPYTMEELQSTIWEDSSYVDLP
LSDKEACKGACLEDCNCEAAIFNGTSCRKQRLPLRYGRREVSTPNLELIKVATCTTAPDT
EKGSKRKGRTDILIIGLSLTAFGSILVAISVVTFCKHNAWSYGRVNIPILDSELNEDIAL
RPYTYEELEKITNNFTEEVGRGASGTVYKGVILASQKRVAVKRLXKVXAEGEKEFQTELK
VIGKTHHKNLVRLLGYCLDGPKRLLVYEYMSNGSLADILFTPDGKPSWEERMRIACNIAR
GFLYLHEECDTQIIHCDIKPQNILMDEYMCPKIADFGLAKLLKADQTRTTTGFRGTRGYV
APEWHRKMPITVKADVYSFGVVLLEIICCRRNVDWSLPDEEAILDELAYHCFETGELGKL
VGEEEVNTRQFERMIKVGLWCIQDEPSLRPSMKKVLLMLEGTVDIPIPPNPISFLSTI
Download sequence
Identical sequences MDP0000288873 MDP0000288873|PACid:22644599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]