SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000289661|PACid:22646223 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000289661|PACid:22646223
Domain Number 1 Region: 79-252
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 9.42e-26
Family Chlorophyll a-b binding protein 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000289661|PACid:22646223
Sequence length 274
Sequence
MAQTMLLMSSSVSSGHVVDLKSSDRLLQVQVQRLRPKSFSQLVFRPLPSSSFASSSSTVV
ALFKSKTKAPAKKAPSPKPKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAIT
GKGILSQLNLETGVPIYEAEPLLLFFILFTLLGAIGALGDRGKFVDDPPTGIEGAVIPPG
KGFKSALGLNEGGPLFGFTKANELFVGRLAQLGFAFSLIGEIITGKGALAQLNIETGVPI
NEIEPLVLLNVVFFFIAAVNPGTGKFITDVDEED
Download sequence
Identical sequences MDP0000289661 MDP0000411498 MDP0000430367 XP_008338774.1.92800 XP_008375547.1.92800 MDP0000289661|PACid:22646223 MDP0000411498|PACid:22622395 MDP0000430367|PACid:22660140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]