SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000290119|PACid:22662781 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000290119|PACid:22662781
Domain Number 1 Region: 454-768
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-75
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 77-153,224-249
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000116
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Weak hits

Sequence:  MDP0000290119|PACid:22662781
Domain Number - Region: 257-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.016
Family EGF-type module 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000290119|PACid:22662781
Sequence length 787
Sequence
MSTFLLSILLAFILSNLPPSSAQQLNSFSSKDSPWTPSQQNKTLLSPNSLFAAGFLSLPN
SPNLFNFSVWYHNISAPNSVVWTANPKSPLAPSATLVITAAGVLRLTNSSAAAGGGNLWP
GPSSSNPNTTRLLLRNDGNLIYGKWESFAFPTDTVLPNQSMTGANFTLLSKNGKFSVVNA
SCLVFNNTDVYQNLTNAFQSLGSEGKVQQANGASFIASDFGLNRSRRLTIDDDGNFRIYS
FDPSLRQWNIVWQAGYELCQVHGTCGPNAICVSDGSSSSYCVCPPGFRESAGGIKDGGCE
RKIKLTNLGNTRFERLDYVNFHGRVEPDQLARHQFQRLRIKMPGEKQLPRIHVQIRRQRL
LRAPAREIVIRVLVARIRNRYVSPGMTELLETTCPVQIRLPLPPEDSNATTRNIVIICTL
FAAELISGVLFFWAFIKKYIKYRDMARTLGLEFLPAGGPKRFSYAELKAATKDFSNLIGK
GGFGDVYKGVLTDQRVVAVKCLKHVAGGDAEFWAEVTIIARMHHLNLVRLWGFCAEKGQR
ILVYEYVPNGSLDKYLFQPGRVTPSDSVEETGVLIDDERKPILDWGIRYRIALGVARSIA
YLHEECLEWVLHCDIKPENILLGDDFCPKISDFGLAKLKKKEDMVTISRMHGTRGYMAPE
WIKADQITPKADVYSFGMVLLELVSGVRNTEIQGSMIESDDWYFPRWAFDKVFKEMNVED
ILDRRIKNSYDSRVHFDAVNRMVQTAMWCLQDRPEMRPSMGKVAKMLEGTVDITEPKKPT
IFFLSDD
Download sequence
Identical sequences MDP0000290119|PACid:22662781 MDP0000290119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]