SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000292294|PACid:22635538 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000292294|PACid:22635538
Domain Number 1 Region: 1332-1628
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-78
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 505-795
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-77
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 3 Region: 905-990,1022-1053
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.28e-25
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 
Domain Number 4 Region: 86-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.3e-24
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 
Weak hits

Sequence:  MDP0000292294|PACid:22635538
Domain Number - Region: 1209-1255
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Hairpin loop containing domain 0.052
Further Details:      
 
Domain Number - Region: 384-431
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0239
Family Anti-platelet protein 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000292294|PACid:22635538
Sequence length 1743
Sequence
MQIGTKTSVNPLNSSMFFLFFFSLLLLSRHHCAEVYEISPAQPLSEGQTLVSPSLVFELG
FFSPNNDSGKNKYVGIWHKSIFPRKVVWVANREKPVAASDTLASLRISSKGNLELVDXKK
NSLWSTNISVPSNGSAAALLDSGNFVVKDDDVGADPLWQSFDYPSDTHLPGMLLGFDSKS
GDTNFLTSWKSESDPSTGMFLVGLTTEVPSQIVVWINGSTPYWRSGPWDKSRYIGLPGTN
NGYINGLKLDDNVRQETKYNFFNFGDTLAYSDISSDGILKLMYSEHGENXILDFVAQNSS
CDKYAACGPFGICKRSESPTTPICKCLKGFAPKSHEEWSKGNRTGGCVRQTKLVCETNTN
QSVASRKTEDGFLKMVRLKVPDFHEYITSLDAXECRTHCLKNCSCLAYAHVNNIGCLVWS
KDLIDMQEFAYGGEDLFVRLDRSELGEGKPIKLISSLTAICLISILGATAFGFQRLRANK
KGNARLTDTFKNTRDTLQEYIRKHDPSELFIYNFXSILIATNNFSITNKLGEGGFGPVYK
GKLEEGKEIAVKRLSSSSGQGMEEFKNEMLXISKLQHKNLVRIMGCCVKDDEKLLIYEFM
PYRSLDTLLFNPTLRAVLDWSRRFNIIQGVARGFLYLHRDSYLKVIHRDLKVSNILLDEK
MNPKISDFGLSRIVEAXQSLSTTHKVVGTLGYMSPEYAMVGVFSEKSDVYSFGXLLLEII
SGSKNTSFYYSEEQLGFLAYAWQLWNEGRGLKFVDEVLADSYSSSEVTRCMHIGLLCVQD
KAADRPTMPDVVFMLSSEKDPPPPKQPIFSNFENSSVFDPHPHYDNIFSVDEVNALNFFM
FFIFFFSLLLLSRHRCVEIYEINPSQPLSEGQSIVSPGHVFELGFFSPNNNSGNNKYVGM
WHKSIFPRKVVWVANREKPIAASDTLANLRISNKGNLELVDGKXNSLWSTNIXVPSNGSA
AALLDSGNFVVKDYDVGADPLWQSFDYPSDTLLPSMLLGFDNKSGDTKFLTSWKSESDPS
MGMFLVXLTPEVPSQIVIWINGSTPYWRSGPWDKSKFIGLPCTNDGYLGGFILDDNVRQG
PKYYSYNFGDTLAYFDISSDGIVKLKCSERGENWILNFVAQNSSCDKYAACGPFGICKSS
ESPTTPICKCLKGFVPKSHEEWSKGNRTGGCVRQTKLVCETNTNQSVASRRNEDGFLKVV
RLKVPDFHEYIWSSDAEECKTRCLNNCSCLAYAYVNNIGCLAWSNDLIDIQEFAYGGQDL
FVRLDRSELGEGKPIKLIASLTAICLICILGAIAFGFQTLRANKKGNGRLTDTIENARDT
LQEYIRKYDPSELFIYNFDSILIATNNFSITNKLGEGGFGPVYKGKLEEGKEIAVKRLSS
SSGQGMEEFENEMLLISKLQHKNLVRIMGCCVKDDEKLLIYEFMPNRSLDTLLFNPXRRA
VLDWGRCFNIIQGVARGLLYLHRDSYLKVIHRDLKVSNILLNEKMNPKISDFGLSRIVEA
AQSLSTTHKVVGTLGYMSPEYAMGGIFSEKSDVYSFGVLLLEIISGRKSTSFYYKEEQQG
FLAYVWHLWNEGRGLKFVDEVLADSYSLSEVTRCMRIGLLCVQDKAADRPTMPDLQSAFS
GKRTPLLIIYERDSKVGERDKPPFSRQRKLGFIIAKTENGEREKRKAQKKSKAGPAMMDA
WASRATLPKHDDGEDPSMTDTWKQWAKAAFRCPKNQREEQPEEKGRDKIVPPLVIHSTTL
IGF
Download sequence
Identical sequences MDP0000292294|PACid:22635538 MDP0000292294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]