SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000293065|PACid:22621196 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000293065|PACid:22621196
Domain Number 1 Region: 410-543
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.56e-34
Family Protein kinases, catalytic subunit 0.00078
Further Details:      
 
Domain Number 2 Region: 66-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-20
Family alpha-D-mannose-specific plant lectins 0.0044
Further Details:      
 
Domain Number 3 Region: 177-273
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000806
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 
Weak hits

Sequence:  MDP0000293065|PACid:22621196
Domain Number - Region: 548-622
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00157
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000293065|PACid:22621196
Sequence length 652
Sequence
MAVALSVEMLLFSSLFLLPISVISQNNGXVAVGSSLTATTGDSSSWLSPSGDFAFGFSPL
GNNDRFLLSIWYAKIPDKTVVWYAYDGNNPMVAPRGSVLNLTANSGLVLNNPQGGEIWKS
EITLGTVANGVMNDTGNFVLQHQNSGSLWETFSNPTDTVLPGQTIERNGTLSCRQSETNY
TKGRFRLSLQGDGNLVLISVTTDNANIPYFSTKTTSGNVPGSQGKRLVFSSSGDMFVLRE
NDGRVPLKGTEGVSVRDNYIRATLDFDGIFALYSHXKNFTGNASWISPLVYMPDDICLRL
GVGVCGYNSTCMLKPDKRPTCECPKGFSFLDPKDIYRGCKPDLSRKSVTRVESVLLADKW
VWIGISIAAALVLCTAYYLXRRRRSALASAGENRPEIENEMLIFMKSKRHHDFSVFSYSS
IVAATRNFAEENKLGQGGFGPVYKGKLATGQEIAVKRLSKCSGQGTSEFKNELILIYELK
HTNLVHLFGFCIHGEEMMLIYEYLQNKSLDHFLFDPIRGLLLDWKKRFSILEGIAQGLLY
LHKYSRKKAWELWKXGAGLEXTDPTLGNSFIKEQLLRCIHVGLLCVEENAADRPTMSDVI
SMLTNESFXLASPTKPAFFVGRRTVEAGISGNQQLETVASANYXSSSDFEAR
Download sequence
Identical sequences MDP0000293065 MDP0000293065|PACid:22621196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]