SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000293658|PACid:22622480 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000293658|PACid:22622480
Domain Number 1 Region: 301-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000908
Family EGF-type module 0.0037
Further Details:      
 
Weak hits

Sequence:  MDP0000293658|PACid:22622480
Domain Number - Region: 268-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00084
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000293658|PACid:22622480
Sequence length 361
Sequence
MALLRRMHILHLSLVMVVVVTILLGIPTPTTAQSLLPPQALPGCPDHCGNLTIPYPFGIG
DGCYLNDRFNITYNISTQPPTAFMMTSNLEITNISLYDGELQILQFTSSDCYDAQGNRTR
RNRPKLWVPPPYTISKTKNVFVAVGCDTYAFFIGYRGEEKYTTGCMSICDNLGKAIDQRD
TCSGFGCCQTKIPGGLQNQTVTLGSLDNYTDVQDSHRCSYAFLVQEGEFNFTSTSFRELN
ETTKLPAIIDWVIGNKSCDIAAKNESTFACKANSSCHTRSSGYICRCWSGYEGNPYLPGG
CQDIDECKAPNPCSMGTCINTPGNYTCKCPKGYKNDDPDKIRCIKANSRAKLSLLLIISL
X
Download sequence
Identical sequences MDP0000293658|PACid:22622480 MDP0000293658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]