SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000293905|PACid:22638518 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000293905|PACid:22638518
Domain Number 1 Region: 439-712
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-75
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 48-159
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.16e-26
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Weak hits

Sequence:  MDP0000293905|PACid:22638518
Domain Number - Region: 321-356
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0942
Family Pan module (APPLE domain) 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000293905|PACid:22638518
Sequence length 750
Sequence
MDQNVKDGDLLVSKENIFALGFFSPRNSSSRYVGIWYAQKDEKDQKAVVWVANRNDPXND
TSGVLTIDRYGRLLLYSNNMQNXPVXSTNVTVQTASTSCRAQLLDSGNLVLFRDNKSKNF
MWQSFDYPTDTLLPGMKLGVNWKLGIEWVLTSWKSQDDPGTGEYTYRLYSNQTATPEVLT
FYKGLTPHWRADLVDVGRSDPLDVGRSXPLXVVTFVSNQDEMWNXADREWKELWSXPKYX
CDQYXECGANSKCSPDNINSFECECLPGYEPKSVNDWKMRDGSDGCVSKRLAVSKCRNGE
GFMKVARVKDPDTTKAARLKKGISIKECEQMCLSNCSCTAYTVIESEGRSDCLTWYGELL
DILVXTXXGXDLHVRVDKIELAENSRNSKGFLRXRGMLAXLMLSVVLALVLMVALTCWRI
RKQRKTKVEIEETRRHPELQFFHLRTIIAATNNFSPVQKLGQGGFGTVYKGVLRNNQNIA
VKRLSRATGQGVEEFKNEVALIARLQHRNLVKLLGCCIKGEERMLVLEYLPNKSLDYFLF
DHTKKSLLDWQKRFEIINGVARGVLYLHQDSRLRIIHRDLKTSNVLLDAEMNPKISDFGM
ARIFHGDQLQDTTNXVVGTYGYMSLEYAVFGRFSTKSDIFSFGVILLEIVWQLWSEDRAL
EIVDSSLESYAPDEAMRCIQVGLLCVEEESKNRPSMSAVVFMLSGEASAPSPQQPAFALR
KNSCGDAVVPSVSEGSCSINDVTITKFEGR
Download sequence
Identical sequences MDP0000293905|PACid:22638518 MDP0000293905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]