SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000294158|PACid:22639033 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000294158|PACid:22639033
Domain Number 1 Region: 302-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000132
Family EGF-type module 0.0037
Further Details:      
 
Weak hits

Sequence:  MDP0000294158|PACid:22639033
Domain Number - Region: 270-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00119
Family EGF-type module 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000294158|PACid:22639033
Sequence length 385
Sequence
MALHRRMHILHLSLVMVVVVTILLATPTPTTAQSLLPPQARPDCPDHCGNLTVPYPFGIG
DGCYLDHRFNITCNSSTQPPTALWMTSDIKITNISLYDGELQKLQYVASDCYDAQGNRTE
WFSPRLSVSPPYTISETKNMFVAVGCDTYAYFTGYRGEDEYTTGCLSICDNLGNAIDQRD
TCSGVGCCQTKFPSGLQNLNVTLGSLSNYRGVQDSHRCSYAFVVQEGEFNFNSTSFRELK
ETTKLPAIIDWVIGNESCDIGAKNESTFACKANSYCHNRSSGGYICRCWSGYEGNPYLPG
GCQDIDECNAPNACSMGTCINTPGNYTCKCPKGYKNDDPDKIRCIKANGRAKLSLLLIIS
LGSCFCIYKGYWVKGKVELGSCVRT
Download sequence
Identical sequences MDP0000294158 MDP0000294158|PACid:22639033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]