SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000294963|PACid:22625041 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000294963|PACid:22625041
Domain Number 1 Region: 407-695
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-76
Family Protein kinases, catalytic subunit 0.0000793
Further Details:      
 
Domain Number 2 Region: 296-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.003
Further Details:      
 
Weak hits

Sequence:  MDP0000294963|PACid:22625041
Domain Number - Region: 263-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00041
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000294963|PACid:22625041
Sequence length 711
Sequence
MALHWRMHILHLSLVMVVVVTILLATPTTAQSQXAXPDCPDRCGNLTXPYPFGIGXGCYL
DDRFXITCNISTQPPTAFMMTGNLEITNISLYDGELQILQYVASDCYDAQGNTIEWYSPW
FTVPPPYTISHTKNTFVALGCDTYSFFIGYRGEEKYTTGCTSICNNLGNAIDQXDTCSGV
GCCQTKIPSGLQNQTXELYSYYNHSDVWEFNPCSYAFLVQEGEFNFNSTSFRELNYTTQX
PAIIDWEIGNESCDIAAKNXGTFGCKANSSCHNRSSGYICRCLPGYEGNPYLPDGCQDID
ECXAPNPCSMGTCINTPGNYTCXCPXGYKNDDPDKIRCIKXXGRAKLXLLLIISLGASGG
LLLLLSGSWIYWGMQRRKFLKLKXKYFKENGGXLLQQKIASQGGSVETTKIFTAEELEKA
TNNYHESRILGEGGYGIVYKGILAADNNKAVAIKKSKIGVPTQKEQFVNELLVLSQINHR
NVVRLLGCCLELEVPLLVYEFVAHGTLFEHIHGKKRKGSSFSLELRLKIAAETAGALAYL
HSSALMQIIHRDVKLTNILLDENYTAKVSDFGASRLIPLDQAQLATLVQGTIGYLDPEYF
HTSQLTDKSDVYSFGVVLMELLTSKLALDSHRPEGEKNLARFFLCLMEEDRLNEILDDDI
LNERNIETIKTVANLAKRCVRLKGEDRPTMKEVAMELEGMRIYRKACMGKS
Download sequence
Identical sequences MDP0000294963|PACid:22625041 MDP0000294963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]