SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000295306|PACid:22673308 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000295306|PACid:22673308
Domain Number 1 Region: 43-138
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.89e-24
Family GDI-like 0.00039
Further Details:      
 
Domain Number 2 Region: 139-178
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000505
Family GDI-like N domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000295306|PACid:22673308
Sequence length 1160
Sequence
MEALKSPLMGLFEKRLARKFILYVQDYSETDPKTHEGMDLTRVRKVGKVARVIAIMSHPI
PNTNESHSVKVILPQKQSDEICIFYVAPTLTMLPLKGKFIAFVSTDAETDHLETELKPGI
DLLGPVDEIFFKTYDIYEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTLITGKAKS
NNHGPIKANQQKSAQSFQPRNIIRFRIVPTQMEYGTPNIQTDGSILHCCKALKIREILTP
FRSSRASLSSLTEEEMSNQNLTSGDRLRTSWTPAMERYFIDLMLDQVHRGNRLGHTFNKQ
AWNDMLMMFNGNFGTPYDMNTLKSHYTSLWRQFNDIKNLLDQNGFSWDNTRQMVIADKYA
WDAYVKVHPDAQVYRNKALMTFNDLCLIYAHTQADGRYSLSSHDIDFDDEIQGMIDGAGM
ISPTPASKVKRNADWKPAMDEFFLNLMLDQLEKGRKMNNTFTKQAWKGMVTLFKKKFGSQ
YQTRFLKQLHKKLLKYYTDVRSILARNGFYWDENRQMIVADDDVWGNCIQALPDARVYRK
KPLLNYQDLNSIYASEISNGLLNHLDQDEEEREGQFSFSGNGHLASFEDLDSEGLDFMTV
HLIATFWWIDGEDIQSHGNDIFSRKDWTPPMDRYLIDLLLEQLQKANKIDYSLDDQAWVD
VLVLFKERFGLXYNKDLLRSRYKSLEKQYHDTKDLLDRRGFWWDETQQMVTAYDDVWDAY
IKERPDTEAYRTKSTPNYNDLCLIYGNSNSGERYNQSGQAVGCNGDAXYNHSYHRRXDWT
PPMDRYFIDLMLEQVRNGSMVNQKFSKLAWTDMVSKFRAQFGSQHDKDVLKSRFVNLRKR
FNDMKTLLDQSGFTWDEMQQRITADGDLWDAHVKASSSHVLVQVRPDARSYRNRTLPNFN
DLCLIYGNEDSLKREGSSNHSMDAEDDDPRVNVGDETQQTIFAEVDDVWDAYVKVLVFLA
NCCLGQKEFPYSKFLVLITPPQHFMEEQYGACACFDHPYQPAYGNSILDYNDSTMIYGNG
VADGRSSYLSTEMGKTGFDMTFGGLQSRTMDYETSIQRKKRKPTASSTSASKRVQRTIKE
EVQEALDEKPQRVNGFVGNEEDKDCCSIERIVDALETVPDMNDELFLEASQILEDESKAK
MFVAMDVTARQKWLFRKLRQ
Download sequence
Identical sequences MDP0000295306 MDP0000295306|PACid:22673308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]