SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000297441|PACid:22661414 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000297441|PACid:22661414
Domain Number 1 Region: 414-547
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.55e-33
Family Protein kinases, catalytic subunit 0.00089
Further Details:      
 
Domain Number 2 Region: 71-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-20
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Domain Number 3 Region: 182-278
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000759
Family alpha-D-mannose-specific plant lectins 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000297441|PACid:22661414
Sequence length 576
Sequence
MGAFAMAVALSVEMLLFSSLFLLPISVISQNNGRVAVGSSLTATTGDSSSWLSPSGDFAF
GFSPLGNNDRFLLSIWYAKIPDKTVVWYAYDGNNPMVAPGGSVLNLTANSGLVLNNPQGG
EIWKSEITLGTVANGVMNDTGNFVLQHQNSGSLWETFSXPTDTVLPGQTIERNGTLSCRQ
SETNYTKGRFQLSLQGDGNLVLISVTTDNANIPYFSTKTTSGNVPGSQGKRLVFSSSGDM
FVLRENDGRVPLKGTEGVSVRDNYIRATLDFDGIFALYSHQKNFTGNASWISPLVYMPDD
ICLRLGVGVCGYNSTCMLKPDKRPTCECPKGFSFLDPKDIYRGCKPDLSRKSVTRVESVL
LDKWVWIGISIAAALVLCTAYYLLXRRRSALASAGENRTTIENEMIIFMKSKRHHDFSVF
SYSSIVAATSNFAEENKLGQGGFGPVYKGKLAXGQEIAVKRLSKCSGQGTSEFKNELILI
YELXHTNLVHLFGFCIHGEEMMLIYEYLQNKSLDHFLFDPIRGLLLDWKKRFSILEGIAQ
GLLYLHKYSRKKEXMHQLELADGFWHLSRYLRSFRV
Download sequence
Identical sequences MDP0000297441|PACid:22661414 MDP0000297441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]