SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000297643|PACid:22630293 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000297643|PACid:22630293
Domain Number 1 Region: 290-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000257
Family EGF-type module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000297643|PACid:22630293
Sequence length 371
Sequence
MALLRRMHILHLSLVMVVVVTILLGIPTPTTAQSLLPPQALPGCPDHCGNLTIPYPFGIG
DGCYLNDRFNITYNISTQPPTAFMMTSNLEITNISLYDGELQILQFTSSDCYDAQGNRTR
RNRPKLWVPPPYTISKTKNVFVAVGCDTYAFFIGYRGEEKYTTGCMSICDNLGKAIDQRD
TCSGFGCCQTKIPGGLQNQTVTLGSLDNYTDVQDSHRCSYAFLVQEGEFNFTSTSFRELN
ETTKLPAIIDWVIGNKSCDIAAKNESTFACKANSSCHTRSSGYICRCWSXIDECNAPNAC
SMGTCINTPGNYTCKCPEGYKNDDPDKIRCIKADGRAKLNLLLIISLGXCFCIYNGXWVK
GKVELGSCVRT
Download sequence
Identical sequences MDP0000297643|PACid:22630293 MDP0000297643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]