SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000298765|PACid:22632619 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000298765|PACid:22632619
Domain Number 1 Region: 487-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-73
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 66-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.56e-21
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  MDP0000298765|PACid:22632619
Domain Number - Region: 175-267
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00738
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Domain Number - Region: 305-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000298765|PACid:22632619
Sequence length 974
Sequence
MEFELPYSVFFLLLLLVILPISTPAQTYNNISLGSSLTALDDNSSSWRSPSGEFAFGFRQ
LGVDGFLLAIWFNKIPERTIVWSANGGSLVPQGSQVELTNDGQFMLKDKTGKQISFAGSL
GITGVAYAAMLDTGNFVLANKSSKYLWESFEEPTNTLLPTQTLNRNSKLYASYTASNYTP
GRFQFALKSDGELLLYTTNYPLDSRNHDYWSTHTEGSGFQVIFSQSGSIYLTGTNGSILN
MLSDNTSSTQDFYHRAMLEYNGVFRHYVYPKKTGSGSVGTRRQGWSSSSFIPSNLCTSIL
ESTGGGACGFNSLCRDDTEGPVCECPDGYSFIDKNDVLKGCKQNFVSQSCDQAFPETHLF
DFQEHENRDWPLSDYQHFQPVSEDWCKQSCLSDCFCAVVIFKNDDCWKKGSPLMNGRIDP
TVGKKALIKIRIDSNNSRKHSNSIPNLARLGLLGSSAFLNLLLLIITCLLFFHIIHHRKA
KLSMLYPGVQGNNLKSFTYMELKGATNGFKXELGRGAFATVFKGVLASEDGKHVAVKRLD
TMVRENDLEFKAEVSAIGRTNHKNLVQLLGFCNEGQXRILVYEFMSNGSLASFLFGESRP
SWYQRREIALGTARGILYLHEECSIQILHCDIKPQNILLDDSFNARIADFGVAKLLKIEQ
TRTTTRFRGTRGYVAPEWFKSLPVTVKADVYSFGILLLEIVCCRKNYEAKMEDEDQMILA
DWAYHCYEQNKLHQLFRNDDDKAKDDIEEMKTYLMIAFWCIQEDASRRPTMRNVTQMLEG
TVELSNPPNPSSLYVQFVYGCPMFIILQKLKALKTCLRQWNFSVFGDVHNRVANARHNLS
MIQQRISTEGINNDLFEEEIVAKTTVMESLQMQETFWKDRARVKWLTKGDRNSSFFHAYA
RIKSSSSHISCILDGNNLLTDPLAIANHIVNFYQTLFGSSFTPSGIDEVCEVIQPMVTDS
ENDLLSALPTDEEI
Download sequence
Identical sequences MDP0000298765 MDP0000298765|PACid:22632619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]