SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000298868|PACid:22632815 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000298868|PACid:22632815
Domain Number 1 Region: 94-137
Classification Level Classification E-value
Superfamily PA domain 0.000000101
Family PA domain 0.011
Further Details:      
 
Weak hits

Sequence:  MDP0000298868|PACid:22632815
Domain Number - Region: 512-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 472-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0187
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 582-656
Classification Level Classification E-value
Superfamily MetI-like 0.0213
Family MetI-like 0.028
Further Details:      
 
Domain Number - Region: 291-396
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0548
Family Thioltransferase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000298868|PACid:22632815
Sequence length 701
Sequence
MELQRSAALRFFLGFLLLSMANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSM
AGAVVYPKENQKGCKEFSEFGITFKSSPGALPTFVLVDRGDCFFALKVWNAQKAGASAVL
VADNIEEALITMDSPEEDGSTSKYIENITIPSALIEKRFGEXLKKAISAGDMVNVNLDWR
EAVPHPDDRVEYELWTNSNDECGVKCDMLMEFMKDFRGAAQILEKGGYTQFTPHYITWYC
PRAFTLSKQCKSQCINHGRYCAPDPEQDFSSGYDGKDVVLENLRQLCVFRVANETKKPWV
WWDYVTDFQIRCPMKEKKYNKECADGVIKSLGLDIKKIESCMGDPNADSENTVLKEEQDA
QVGKGTRGDVTILPTVVVNNHQYRGKLEKGAVLKAICSGFEETTEPAVCLSTDVETNECL
DNNGGCWQDKAANLTACKDTFRGRVCECPLVDGVQFKGDGYTTCEASGPGRCKVNNGGCW
HEARDGHVFTACTDNGKVQCQCPPGFKGXGVKSCEDIDECKDRKACQCPECSCKNTWGSY
DCSCSGNLLYIRDHDTCISESRNSGAFTFSEYVYCKSSGGGKSSAWVAVWVILIGLAMAA
GGAYLVYKYRLRVSFLCFISSLQTSYISLLMLESPINGGIIGSSLVAVVLRLTILCLSML
DASGELWLCSYMDSEIRAIMAQYMPLDSQAEVPNHVNEERA
Download sequence
Identical sequences MDP0000298868|PACid:22632815 MDP0000298868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]