SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000299806|PACid:22682346 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000299806|PACid:22682346
Domain Number 1 Region: 237-529,633-676
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.22e-72
Family FAD-linked reductases, N-terminal domain 0.0000272
Further Details:      
 
Domain Number 2 Region: 510-623
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.64e-26
Family L-aminoacid/polyamine oxidase 0.00035
Further Details:      
 
Domain Number 3 Region: 128-227
Classification Level Classification E-value
Superfamily Homeodomain-like 6.27e-22
Family SWIRM domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000299806|PACid:22682346
Sequence length 815
Sequence
MEKTDNPLNHSDNPPNDVVFDDSSPETDLTPSSSTPHENHSSENPSAPPQTTLEAPVSDS
QDDSSEPILEGEDTLLDQQHLQNPIEAGPAEPGLPAKRRRRRKKFFTELNGSPSLAKNRR
TDLNKDVDVEALIAISVGFPVDSLTEEEIEANVVPTIGGVEQANYIVVRNHILSRWRSNV
SFWLTRELALESIRSEHKGLVDSAYDFLVEHGYINFGLAPAVKEAKLRSFDGAERGNVVI
VGAGLAGLVAARQLVFLGFKVVVLEGRSRPGGRVKTRKMVGEREGVEAAADLGGSVLTGI
NGNPLGVLARQLGLPLHKVRDICPLYLPDGKAVNSEMDSSIETSFNKLLDRVCKLRHAMI
EEVKSVDVPLGTALEAFRRVYSVARDTQERMLLDWHLANLEYANASLMSNLSMAYWDQDD
PYEMGGDHCFIPGGNETFVRSLAEGLPIFYERTVQSIRYGSDGVLVYANGQEFRGDMVLC
TVPLGVLKKGSIEFVPGLPQRKKDAIQSIGFGLLNKVAILFPYNFWGGDIDTFGHLTEDP
RMRGEFFLFYSYSSVSGGPLLVALVAGDAAIKFELMSPVESVNRVLDILRGIFNPKGIAV
PEPIQAVCTRWGKDDFAYGSYSYVAVGSSGDDYDILAESIGDGRVFFAGEATNKQYPATM
HGAFLSGMREAANILRVAKKRSIIPLEKPSNVGDEMDDLNKLFDTPDVRCGSFSVLFDPR
SNEFDSANSLLRVKFGVGNMEVGSRLSLCLYGLISRNQAMKLSEVEGDGNKMRMINVEFG
VRLVGRKGLSGAGESLISYIKTAKSKPNVVGGVQL
Download sequence
Identical sequences MDP0000299806|PACid:22682346 MDP0000299806 XP_008377098.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]