SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000300325|PACid:22651602 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000300325|PACid:22651602
Domain Number 1 Region: 253-576
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-81
Family Protein kinases, catalytic subunit 0.0000941
Further Details:      
 
Domain Number 2 Region: 3-114
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.75e-21
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000300325|PACid:22651602
Sequence length 587
Sequence
MTVVWVANREIPVSDRFSSVLSILDGNLVXLNQSKTLVWSTXLNSTTTSGSXQAVLLDSG
NFVLRAGSSNNTSEPLWQSFDHPTHTWLPXGRLGFNKITNHTQTLTSWKNSENPAPGLYS
LELAPDESSSYILLWNRSKQYWISAPWNXSSHIFKVAPENQMFNYSYVTNENESNSYCSI
WHGDVFLPELVASDGLIKPSLVIAIVTTVTGLLLVIFGYFLWKKTXGKKREQRNRYGETK
SKFAAGGENNDAELPIFGLRAIIAATNNFAEANKLGEGGFGPVYKGILAENQEVAIKRLS
KKSGQGQQEFMNELKLIAKLQHTNLVRLLGCCLEEEEMILIYEYMPNRSLDKLLFDASEK
RELDWGRRFRIIEGIAQGVLYIHKYSRLKIIHRDLKASNILLDXXLNPKISDFGMARIFX
INQXEANTNRVVGTYGYMSPEYARYGHFSEKLDVFSFGVLLLEIVSGKKNAAFYXFEHSP
TLAGWAWELWKDGRGMEVIDESVREMRHLDEALKCIHIGFLCVQEAPADRPTMSSVIRML
QGNESTSLPPSKEPAFSTHRNSNHVHPSKTPTSFSHNVVTMSFPEGR
Download sequence
Identical sequences MDP0000300325|PACid:22651602 MDP0000300325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]