SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000300498|PACid:22652001 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000300498|PACid:22652001
Domain Number 1 Region: 620-910
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-79
Family Protein kinases, catalytic subunit 0.0000728
Further Details:      
 
Domain Number 2 Region: 278-388
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-20
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  MDP0000300498|PACid:22652001
Domain Number - Region: 522-579
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0628
Family Pan module (APPLE domain) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000300498|PACid:22652001
Sequence length 1063
Sequence
MVKKGEIEILHLSTEKMIADPLTKALPNXVFKAHVTRMGILEAFDNLHLLGDGHRGSGRY
PRRQIEGCPQMEVVDKPEKVVLPTNESSESLIRIRHTVIIFSLNNGGKQHKDLSTYSKIT
KLLVEKNASDTWRGEGIRYSRSIFGSDVLCVQERASDRPTMAEVTFTRHYVVLNFMTKMK
GKIIHYGRTRTDLAPFRANLIYLLNTTGSRATVLLXFLVILPSSISVTLDAITXXQPLRE
XDVLLSTTKXFALGFFKPGNSXNRYIGVWYNKIPIKTIVWIANRENPIVPTAGTGLLAIH
GDHGGLVIYGEDQNTPIWSANLTVSSPNNSVIAKLSNKGNLVVEINGEKVWQGFDYPTNT
MLPFMKIGLDRRSRLNRFLTSWKSQDDPGMGNCSFRMEPSESPQEFLYKGQTRLWRTGPW
TGNIERSAWDDEVHKWVPHWXPDWQCDSYGVCGPNSICYPYPNFXDKFECKCLPGFEPKL
QHEWYLRDWSGGCVRQKGPSVCQNGEGFVKLERVKXPDTSTARVNMSXSREACKEECLRN
CSCTAYANADERQGGSGCITWHGDLIDTRTFLDTGQDLYVRVDANVSGXRSQXKFFNATI
ASTSWEDSSARTNIDESGINSELPFFELSXIVKATNNFASNNKLGTGGFGSVYKGVLDNG
KEIAVKRLAKNSGQGIGEFKNEVVLLSKLQHRNLVRIMGCCVQDEEKMLIYEYLPNKSLD
FFIFAKGAFLDWTRCFEIICGIARGILYLHQDSRLKIIHRDLKASNVLLDSAMNPKISDF
GMARIFGAEQIEANTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVTGRKNIGY
HHDSPYSNLVGHVWDLWKENXALEIIDSSLGESYPVNEVLRCIHIALLCVQEQAKDRPLM
SAVVSMLGNDAXIPSPKQPGFLLKRGYHTSGDPSTNTDXACSVNEXTYTEAEGRDTKVVX
XVLSDVSGLINXGRTGRWEHIGPLDVTRNVAQXLMREYKLYETLCMNDIKGYVINEIVRC
IQLPSCVLKSMLLTGQPCRRLFSKTAXIFIEEELYLWRSINKY
Download sequence
Identical sequences MDP0000300498|PACid:22652001 MDP0000300498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]