SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000306147|PACid:22679041 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000306147|PACid:22679041
Domain Number 1 Region: 679-931,1034-1078
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.46e-58
Family FAD-linked reductases, N-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 913-1024
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.18e-28
Family L-aminoacid/polyamine oxidase 0.00034
Further Details:      
 
Domain Number 3 Region: 421-516
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000108
Family SWIRM domain 0.044
Further Details:      
 
Domain Number 4 Region: 1163-1248
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000034
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000306147|PACid:22679041
Sequence length 1635
Sequence
MVDKIDGKEKKSGLKIRSKFVEANMVDSEDDEPIGSLLTLKRQTNPKKVKGGGERGKKVD
DEEDDLGCLDDTLASLRKKLKGPKKDYGTGTMRGRSFALDSVQSAERYSNGHVDDGGLDG
KSVSRVLEKDPVMGDDGSDVTIGIEVENKLNGKGKRPKISGSLGFGEGSNCLLDHHPEDS
LSAFSRKSQSGLIMNSRASSXPKEKSGSKVLEDGLNTMPLAVQDVLGRCTSAADCATSSP
ARKGILRPRYNDDLLDKSCEDMSEDKQLIGDELGSDWCPKFSQRTQHQLSNFASNNLGME
DTRSNCNGLISYTKNPGLASGPLREENDVPNHDHLITSEEADENESFPEDTVSLPDVENK
NTKLSAVQRVGCIVKKRRHGDMAYEGDADWEVLINDQSLDSDNLRVKFDSSSSIGTESES
GEAAAVSTGLKAHAVGPVEKIKFKEILKRRGGVQDYLECRNQILALWNKDVSRILPLADC
GVTDTACADEPPRASLIRDIYTFLDLSGYINIGIAREKDKAESDPKHDYKILREKNFEEI
FGVSVADSEDGVSFITGQVKSSKTKIDAKSGVIIKSDKLTQEVTKDNGLVTTAALELSNT
KNHAEFEADHPENTSVDARLQSKLDNMDVSSIYPISETLGDGGIPHETPELKNVSHSTQC
ASQDHAVRNNNPQCCPEVKKKIIVIGAGPAGLIAVCNLQRQGFSVTILEARSRIGGRVYT
DRLSLSVPVDLGASIITGVEADWATERRPDPSSLVCAQLGLELTVLNSDCPLYDIATGXK
VPADLDEALEAEFNSLLDDMEVSLPNWNQDDVYGGFGGAHCXIKGGYSTVVESLGEXLXI
HLNHVVTDISYXTKDAGLNTNRXNKVKVSTSNGSDFSGDAILITVPLGCLKAETIKFSPP
LPHWKHSSILRLGFGVLNKVVLEFPXVFWDDSVDYFGATAEETELRGQCFMFWNVKKTVG
APVLIALVVGKAAIDGQNMSSSEHVNHAIVVLRKLFGEASVPDPVASVVTDWGKDPFSYG
AYSYVAVGASGEDYDILGRPVENCLFFAGEATCKEHPDTVGGAMMSGLREAVRIIDILTT
GNDYTAEADAIAGIQRQSDSERAEVRDITRRLDAVELSDVLYMNKEALLQDMFFNAKTTK
GRLHLAKELLSLPVETLKSFAGTKEGLTTLNSWILDSMGKAGTQLLRHCVRLLVLVSTDL
LAVRLSGIGKTVREKVCVHTSRDIRAIASQLVNVWLEVFRKEKASNGALKLSRQATAADA
LRRKPIKDPSSGKPPLHTFHGDLEHKGSLQDSASTASHLPLNANGKKVNGKPIKGETANS
SKSEINSSRFRGSTGRPHSELKENDVAVTEAEQAAIAAAEAARAAALAAAEAYASSEAKS
GTLLQLPKIPSFHKFARREQYPQMDEYDFRRKWSGGDLGRQDCISEIDSRNCKVRDWSVD
FSATCVNIDSSRMSVDNLSQRSNPNETGSQTNIREHSGESAAVDSSIYTRAWVDTAGSAG
IKDYHAIEMWQSQAAAVDPDFFHPEPYIHDEEGSNTTSRKHSWKHEGHVNEGSVSQVTVN
KESLKNHXRGADNIKQAVVDYVASLLMPLYKAKKIDREGYKSIMKKSATKVMELATDSEK
AMAVYEFLDFKRRNK
Download sequence
Identical sequences MDP0000306147 MDP0000306147|PACid:22679041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]