SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000308145|PACid:22651384 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000308145|PACid:22651384
Domain Number - Region: 109-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000308145|PACid:22651384
Sequence length 146
Sequence
MPLIGNVSANTFRDEEASSVIAENLCPEVEANIETEAVDVQRCRRDVDCFFFLPICEGLK
YCDRGWCKCFEGQVIIDPPLASVEAYNSATAVEEAAADAKCWRDVDREFAVKCPPGDIKF
CVHGKCECVEGSKNPPPADEAPNLEN
Download sequence
Identical sequences MDP0000308145 MDP0000308145|PACid:22651384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]